APEX1 Recombinant monoclonal antibody, PBS Only (Detector)

APEX1 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 86719-1-PBS
Clone No.251693G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

APE, APE1, APE-1, APEN, APEX

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86719-1-PBS targets APEX1 as part of a matched antibody pair:

MP02621-2: 86719-3-PBS capture and 86719-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0251

Product name: Recombinant human APEX1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-318 aa of BC002338

Sequence: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Predict reactive species
Full Name APEX nuclease (multifunctional DNA repair enzyme) 1
Calculated Molecular Weight 36 kDa
Observed Molecular Weight36 kDa
GenBank Accession NumberBC002338
Gene Symbol APEX1
Gene ID (NCBI) 328
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP27695
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

APEX1, also named as APE, APE1, HAP1 and REF-1, belongs to the DNA repair enzymes AP/ExoA family. It is a multifunctional protein that plays a central role in the cellular response to oxidative stress. The two major activities of APEX1 are in DNA repair and redox regulation of transcriptional factors. APEX nuclease is a DNA repair enzyme having apurinic/apyrimidinic (AP) endonuclease, 3-prime,5-prime-exonuclease, DNA 3-prime repair diesterase, and DNA 3-prime-phosphatase activities. On the other hand, APEX1 also exerts reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. APEX1 is involved in calcium-dependent down-regulation of parathyroid hormone (PTH) expression by binding to negative calcium response elements (nCaREs). When acetylated at Lys-6 and Lys-7, APEX1 stimulates the YBX1-mediated MDR1 promoter activity, leading to drug resistance. It also acts as an endoribonuclease involved in the control of single-stranded RNA metabolism. It plays a role in regulating MYC mRNA turnover by preferentially cleaving in between UA and CA dinucleotides of the MYC coding region determinant (CRD). In association with NMD1, APEX1 plays a role in the rRNA quality control process during cell cycle progression.

Loading...
||
New chat Able
正在加载,请稍候...