AP3S2 Recombinant monoclonal antibody, PBS Only (Detector)

AP3S2 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 86795-1-PBS
Clone No.251741C11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

Adaptor-related protein complex 3 subunit sigma-2, AP 3 complex subunit sigma 2, AP 3 complex subunit sigma 3B, AP-3 complex subunit sigma-2, AP-3 complex subunit sigma-3B

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86795-1-PBS targets AP3S2 as part of a matched antibody pair:

MP02806-1: 86795-2-PBS capture and 86795-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7565

Product name: Recombinant human AP3S2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-193 aa of BC002785

Sequence: MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV

Predict reactive species
Full Name adaptor-related protein complex 3, sigma 2 subunit
Calculated Molecular Weight 22 kDa
Observed Molecular Weight22 kDa
GenBank Accession NumberBC002785
Gene Symbol AP3S2
Gene ID (NCBI) 10239
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP59780
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AP3S2 is a 22-kDa protein that belongs to the adaptor complexes small subunit family. AP3S2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP-3 complex is composed of two large adaptins (AP3D1 and AP3B1 or AP3B2), a medium adaptin (AP3M1 or AP3M2) and a small adaptin (APS1 or AP3S2).

Loading...
||
New chat

Able

正在加载,请稍候...