Product Information
86979-1-PBS targets ID3 as part of a matched antibody pair:
MP02842-1: 86979-1-PBS capture and 86979-2-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0588 Product name: Recombinant human ID3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003107 Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH Predict reactive species |
| Full Name | inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
| Calculated Molecular Weight | 119 aa, 13 kDa |
| Observed Molecular Weight | 13-15 kDa |
| GenBank Accession Number | BC003107 |
| Gene Symbol | ID3 |
| Gene ID (NCBI) | 3399 |
| RRID | AB_3745251 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02535 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
The helix-loop-helix (HLH) family of transcription factors plays a central role in the regulation of cell growth, differentiation and tumourigenesis. Members of the Id (inhibitor of DNA binding) class of these nuclear proteins are able to heterodimerise with and thereby antagonise the functions of other transcription factors of this family. Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3, synonym: HEIR-1) is a member of the ID family of HLH proteins, which lacks a basic DNA-binding domain and inhibits transcription through formation of nonfunctional dimers that are incapable of binding to DNA.









