Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, Ramos cells, Jurkat cells, NIH/3T3 cells, HSC-T6 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
86979-1-RR targets ID3 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag0588 Product name: Recombinant human ID3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC003107 Sequence: MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEILQRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH Predict reactive species |
| Full Name | inhibitor of DNA binding 3, dominant negative helix-loop-helix protein |
| Calculated Molecular Weight | 119 aa, 13 kDa |
| Observed Molecular Weight | 13-15 kDa |
| GenBank Accession Number | BC003107 |
| Gene Symbol | ID3 |
| Gene ID (NCBI) | 3399 |
| RRID | AB_3745251 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02535 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The helix-loop-helix (HLH) family of transcription factors plays a central role in the regulation of cell growth, differentiation and tumourigenesis. Members of the Id (inhibitor of DNA binding) class of these nuclear proteins are able to heterodimerise with and thereby antagonise the functions of other transcription factors of this family. Inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3, synonym: HEIR-1) is a member of the ID family of HLH proteins, which lacks a basic DNA-binding domain and inhibits transcription through formation of nonfunctional dimers that are incapable of binding to DNA.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ID3 antibody 86979-1-RR | Download protocol |
| WB protocol for ID3 antibody 86979-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





