PSMB9 Recombinant monoclonal antibody, PBS Only (Capture)

PSMB9 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 87013-1-PBS
Clone No.252148A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

LMP2, EC:3.4.25.1, Proteasome subunit beta type-9, Proteasome subunit beta-1i, PSMB6i

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87013-1-PBS targets PSMB9 as part of a matched antibody pair:

MP02846-1: 87013-1-PBS capture and 87013-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6048

Product name: Recombinant human PSMB9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-219 aa of BC065513

Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Calculated Molecular Weight 23 kDa
Observed Molecular Weight20-23 kDa
GenBank Accession NumberBC065513
Gene Symbol PSMB9
Gene ID (NCBI) 5698
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP28065
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is an essential component of the cellular protein degradation machinery . It can be isolated as a 20 S particle containing more than 15 different subunits ranging in molecular masses from 20-35 kDa. The proteasome can also be isolated as part of a higher molecular mass particle of 26 S which has been shown to rapidly degrade both ubiquitinated and nonubiquitinated proteins in a ATP-dependent fashion. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC. (PMID: 1429565)

Loading...
||
New chat

Able

正在加载,请稍候...