PSMB9 Recombinant monoclonal antibody

PSMB9 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 87013-1-RR
Clone No.252148A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

LMP2, EC:3.4.25.1, Proteasome subunit beta type-9, Proteasome subunit beta-1i, PSMB6i

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, Ramos cells, Daudi cells, Raji cells, mouse spleen tissue, rat spleen tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87013-1-RR targets PSMB9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6048

Product name: Recombinant human PSMB9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-219 aa of BC065513

Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Predict reactive species
Full Name proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
Calculated Molecular Weight 23 kDa
Observed Molecular Weight20-23 kDa
GenBank Accession NumberBC065513
Gene Symbol PSMB9
Gene ID (NCBI) 5698
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP28065
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is an essential component of the cellular protein degradation machinery . It can be isolated as a 20 S particle containing more than 15 different subunits ranging in molecular masses from 20-35 kDa. The proteasome can also be isolated as part of a higher molecular mass particle of 26 S which has been shown to rapidly degrade both ubiquitinated and nonubiquitinated proteins in a ATP-dependent fashion. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC. (PMID: 1429565)

Protocols

Product Specific Protocols
WB protocol for PSMB9 antibody 87013-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...