PSMB9 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 87013-1-RR (same clone as 87013-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87013-1-RR (PSMB9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87013-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02846-1

  The mean PSMB9 concentration was determined to be 5.1 ng/mL in HL-60 cell extract based on a 1.3 mg/mL extract load, HEK-293T cell extract were served as a negative control.

• 

  Cytometric bead array standard curve of MP02846-1

  Cytometric bead array standard curve of MP02846-1, PSMB9 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87013-1-PBS. Detection antibody: 87013-3-PBS. Standard:Ag6048. Range: 0.312-40 ng/mL.

• 

  Affinity and Kinetic Characterization of 87013-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87013-1-RR against Human PSMB9 were performed. The affinity constant is 0.237 nM.

PSMB9 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 87013-1-PBS

Clone No.252148A4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

LMP2, EC:3.4.25.1, Proteasome subunit beta type-9, Proteasome subunit beta-1i, PSMB6i

---

Product Information

87013-1-PBS targets PSMB9 as part of a matched antibody pair:

MP02846-1: 87013-1-PBS capture and 87013-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6048

  Product name: Recombinant human PSMB9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-219 aa of BC065513

  Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

• Full Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC065513
• Gene Symbol: PSMB9
• Gene ID (NCBI): 5698
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P28065
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is an essential component of the cellular protein degradation machinery . It can be isolated as a 20 S particle containing more than 15 different subunits ranging in molecular masses from 20-35 kDa. The proteasome can also be isolated as part of a higher molecular mass particle of 26 S which has been shown to rapidly degrade both ubiquitinated and nonubiquitinated proteins in a ATP-dependent fashion. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC. (PMID: 1429565)