SAP30BP Recombinant monoclonal antibody, PBS Only (Capture)

SAP30BP Uni-rAb® Recombinant Antibody for WB, IF/ICC, Sandwich ELISA, Indirect ELISA
Cat No. 87054-1-PBS
Clone No.252137B1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Sandwich ELISA, Indirect ELISA

HTRG, HTRP, SAP30-binding protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87054-1-PBS targets SAP30BP as part of a matched antibody pair:

MP03025-1: 87054-1-PBS capture and 87054-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15051

Product name: Recombinant human SAP30BP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-308 aa of BC007592

Sequence: MAGKKNVLSSLAVYAEDSEPESDGEAGIEAVGSAAEEKGGLVSDAYGEDDFSRLGGDEDGYEEEEDENSRQSEDDDSETEKPEADDPKDNTEAEKRDPQELVASFSERVRNMSPDEIKIPPEPPGRCSNHLQDKIQKLYERKIKEGMDMNYIIQRKKEFRNPSIYEKLIQFCAIDELGTNYPKDMFDPHGWSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVTGTKKGTTTNATSTTTTTASTAVADAQKRKSKWDSAIPVTTIAQPTILTTTATLPAVVTVTTSASGSKTTVISAVGTIVKKAKQ

Predict reactive species
Full Name SAP30 binding protein
Calculated Molecular Weight 308 aa, 34 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC007592
Gene Symbol SAP30BP
Gene ID (NCBI) 29115
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UHR5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SAP30BP, also named as SAP30-binding protein, is a 308 amino acid protein, which belongs to the HCNGP family. SAP30BP localizes in Nucleus and Interacts with SAP30. DDX54 Induces cell death and may act as a transcriptional corepressor of a gene related to cell survival. SAP30BP may be involved in the regulation of beta-2-microglobulin genes.

Loading...
||
New chat

Able

正在加载,请稍候...