Use Able AI chat for product recommendations

CLPP Recombinant monoclonal antibody, PBS Only (Capture)

CLPP Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 87187-3-PBS
Clone No.252470B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Sandwich ELISA, Indirect ELISA

ATP-dependent Clp protease proteolytic subunit, mitochondrial, EC:3.4.21.92, Endopeptidase Clp

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

87187-3-PBS targets CLPP as part of a matched antibody pair:

MP02909-2: 87187-3-PBS capture and 87187-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8325

Product name: Recombinant human CLPP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-277 aa of BC002956

Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

Predict reactive species
Full Name ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC002956
Gene Symbol CLPP
Gene ID (NCBI) 8192
RRIDAB_3745397
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16740
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.

Loading...
||
New chat

Able

正在加载,请稍候...