CLPP Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CLPP Recombinant monoclonal antibody (87187-3-RR)

• 

  WB analysis using 87187-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87187-3-RR (CLPP antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87187-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87187-3-RR against Human CLPP were performed. The affinity constant is 0.382 nM.

CLPP Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87187-3-RR

Clone No.252470B7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ATP-dependent Clp protease proteolytic subunit, mitochondrial, EC:3.4.21.92, Endopeptidase Clp

---

Tested Applications

• Positive WB detected in: HEK-293T cells, A549 cells, Saos-2 cells. A431 cells, K-562 cells, mouse heart tissue, rat heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87187-3-RR targets CLPP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8325

  Product name: Recombinant human CLPP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-277 aa of BC002956

  Sequence: MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST

• Full Name: ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC002956
• Gene Symbol: CLPP
• Gene ID (NCBI): 8192
• RRID: AB_3745397
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q16740
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CLPP is the putative ATP-dependent Clp protease proteolytic subunit and also named as endopeptidase Clp. It belongs to the peptidase S14 family. Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. It may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.