MUL1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MUL1 Recombinant monoclonal antibody (87235-1-RR)

• 

  WB analysis using 87235-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87235-1-RR (MUL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87235-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87235-1-RR (MUL1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 87235-1-RR

  WB result of MUL1 antibody (87235-1-RR; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-MUL1 transfected SH-SY5Y cells.

• KD/KO Validated

MUL1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87235-1-RR

Clone No.252482F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C1orf166, E3 SUMO-protein ligase MUL1, E3 ubiquitin-protein ligase MUL1, EC:2.3.2.27, GIDE

---

Tested Applications

• Positive WB detected in: HeLa cells, RAW 264.7 cells, SH-SY5Y cells, J774A.1 cells, PC-12 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87235-1-RR targets MUL1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9119

  Product name: Recombinant human MUL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-239 aa of BC010101

  Sequence: SVYRQKARVSQELKGAKKVHLGEDLKSILSEAPGKCVPYAVIEGAVRSVKETLNSQFVENCKGVIQRLTLQEHKMVWNRTTHLWNDCSKIIHQRTNTVPFDLVPHEDGVDVAVRVLKPLDSVDLGLETVYEKFHPSIQSFTDVIGHYISGERPKGIQETEEMLKVGATLTGVGELVLDNNSVRLQPPKQGMQYYLSSQDFDSLLQRQESSVRL

• Full Name: mitochondrial E3 ubiquitin ligase 1
• Calculated Molecular Weight: 352 aa, 40 kDa
• Observed Molecular Weight: 35-41 kDa
• GenBank Accession Number: BC010101
• Gene Symbol: MUL1
• Gene ID (NCBI): 79594
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q969V5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mitochondrial ubiquitin ligase 1 (MUL1),MAPL, MULAN, or gGIDE, was identified as an E3 protein ligase by three independent groups. Work in mammalian systems shows that MUL1 has small ubiquitin-like modifier (SUMO) ligase activity, stabilizing Drp1, or ubiquitin ligase activity, degrading Mfn. MUL1 expression in mammalian cells results in smaller and more fragmented mitochondria.