Home
Products
Primary Antibodies
Recombinant Antibodies
Mouse ST6GAL1 Recombinant monoclonal antibody, PBS Only (Capture) (87468-1-PBS)

Filter: AllWBSandwich ELISA sample testSandwich ELISAIHCIF/ICCAffinity

WB analysis of 4T1 using 87468-1-RR (same clone as 87468-1-PBS)
4T1 cells were subjected to SDS PAGE followed by western blot with 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87468-1-PBS in a different storage buffer formulation.
WB analysis using 87468-1-RR (same clone as 87468-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 87468-1-RR (ST6GAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87468-1-PBS in a different storage buffer formulation.
Sandwich ELISA sample test of MP03142-1
Serum of six mice was measured. The mouse ST6GAL1 concentration of detected samples was determined to be 1.60 ng/mL with a range of 0.34 - 4.13 ng/mL.
Sandwich ELISA standard curve of MP03142-1
Sandwich ELISA standard curve of MP03142-1, Mouse ST6GAL1 Recombinant Matched Antibody Pair - PBS only. 87468-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg5251. 87468-2-PBS was HRP conjugated as the detection antibody. Range: 62.5-2000 pg/mL
IHC staining of mouse liver using 87468-1-RR (same clone as 87468-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87468-1-PBS in a different storage buffer formulation.
IHC staining of mouse liver using 87468-1-RR (same clone as 87468-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87468-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 87468-1-RR (same clone as 87468-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87468-1-PBS in a different storage buffer formulation.
IHC staining of mouse spleen using 87468-1-RR (same clone as 87468-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87468-1-PBS in a different storage buffer formulation.
IF Staining of 4T1 using 87468-1-RR (same clone as 87468-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed 4T1 cells using ST6GAL1 antibody (87468-1-RR, Clone: 251963F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87468-1-PBS in a different storage buffer formulation.
Affinity of 87468-1-RR
Biolayer interferometry (BLl) kinetic assays of 87468-1-RR against Mouse ST6GAL1 were performed. The affinity constant is 0.19 nM.

Mouse ST6GAL1 Recombinant monoclonal antibody, PBS Only (Capture)

Name: Mouse ST6GAL1 Recombinant monoclonal antibody, PBS Only (Capture)
Brand: Proteintech
SKU: 87468-1-PBS

ST6GAL1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA

Cat No. 87468-1-PBS

Clone No.251963F1

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF/ICC, Sandwich ELISA, Indirect ELISA

Synonyms

Alpha 2,6-ST 1, Beta-galactoside alpha-2,6-sialyltransferase 1, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, EC:2.4.3.1, Sialyltransferase 1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

87468-1-PBS targets ST6GAL1 as part of a matched antibody pair:

MP03142-1: 87468-1-PBS capture and 87468-2-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg5251 Product name: Recombinant mouse ST6GAL1 protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 27-403 aa of NM_001252505.1 Sequence: KKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAVFSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHKCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRFLKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWELWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC Predict reactive species
Full Name	beta galactoside alpha 2,6 sialyltransferase 1
Calculated Molecular Weight	47 kDa
Observed Molecular Weight	39-42 kDa and 49-50 kDa
GenBank Accession Number	NM_001252505.1
Gene Symbol	St6gal1
Gene ID (NCBI)	20440
RRID	AB_3745566
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q64685
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

ST6GAL1 is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle (PMID: 15049997, PMID: 23358684). Two molecular forms of ST6GAL1 are generally observed, a larger 49-50 kDa and a smaller 39-42 kDa form, representing its full-length and the smaller soluble catalytic domain, respectively (PMID: 35676533, PMID: 35661210).