ST6GAL1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ST6GAL1 Recombinant monoclonal antibody (87468-1-RR)

• 

  WB analysis of 4T1 using 87468-1-RR

  4T1 cells were subjected to SDS PAGE followed by western blot with 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 87468-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87468-1-RR (ST6GAL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 87468-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 87468-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 87468-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse spleen using 87468-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 87468-1-RR (ST6GAL1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of 4T1 using 87468-1-RR

  Immunofluorescent analysis of (4% PFA) fixed 4T1 cells using ST6GAL1 antibody (87468-1-RR, Clone: 251963F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity of 87468-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87468-1-RR against Mouse ST6GAL1 were performed. The affinity constant is 0.19 nM.

ST6GAL1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 87468-1-RR

Clone No.251963F1

Host / Isotype

Rabbit / IgG

Reactivity

mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Alpha 2,6-ST 1, Beta-galactoside alpha-2,6-sialyltransferase 1, CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1, EC:2.4.3.1, Sialyltransferase 1

---

Tested Applications

• Positive WB detected in: 4T1 cells, mouse liver tissue, rat liver tissue
• Positive IHC detected in: mouse liver tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: 4T1 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87468-1-RR targets ST6GAL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples.

• Tested Reactivity: mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5251

  Product name: Recombinant mouse ST6GAL1 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-403 aa of NM_001252505.1

  Sequence: KKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAVFSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHKCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRFLKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWELWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC

• Full Name: beta galactoside alpha 2,6 sialyltransferase 1
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 39-42 kDa and 49-50 kDa
• GenBank Accession Number: NM_001252505.1
• Gene Symbol: St6gal1
• Gene ID (NCBI): 20440
• RRID: AB_3745566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q64685
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ST6GAL1 is a sialyltransferase mediating the glycosylation of proteins and lipids to form functionally important glycoproteins and glycolipids in the Golgi compartment. It is principally expressed in liver, placenta, and skeletal muscle (PMID: 15049997, PMID: 23358684). Two molecular forms of ST6GAL1 are generally observed, a larger 49-50 kDa and a smaller 39-42 kDa form, representing its full-length and the smaller soluble catalytic domain, respectively (PMID: 35676533, PMID: 35661210).