Home
Products
Primary Antibodies
Recombinant Antibodies
Claudin 1 Recombinant monoclonal antibody, PBS Only (Capture) (87782-2-PBS)

Claudin 1 Recombinant monoclonal antibody, PBS Only (Capture)

Name: Claudin 1 Recombinant monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 87782-2-PBS-100UG

Claudin 1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 87782-2-PBS

Clone No.253345A9

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

Caudin 1, CLDN1, Claudin-1, CLD1, ILVASC

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBSandwich ELISA sample testSandwich ELISAIHCIF-PIF/ICCCytometric bead array sample testCytometric bead array

WB analysis of HT-29 using 87782-2-RR (same clone as 87782-2-PBS)
HT-29 cells were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 87782-2-RR (same clone as 87782-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 87782-2-RR (same clone as 87782-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA sample test of MP03201-1
The mean Claudin 1 concentration was determined to be 67.6 ng/mL in HUVEC cell extract based on a 1.5 mg/mL extract load and 5.0 ng/mL in MDA-MB-231 cell extract based on a 1.2 mg/mL extract load.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Sandwich ELISA standard curve of MP03201-1
Sandwich ELISA standard curve of MP03201-1, Human Claudin 1 Recombinant Matched Antibody Pair - PBS only. 87782-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag29269. 87782-1-PBS was HRP conjugated as the detection antibody. Range: 78.1-2500 pg/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 87782-2-RR (same clone as 87782-2-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 87782-2-RR (Claudin 1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human skin using 87782-2-RR (same clone as 87782-2-PBS)
Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 87782-2-RR (Claudin 1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of rat colon using 87782-2-RR (same clone as 87782-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
IF Staining of mouse colon using 87782-2-RR (same clone as 87782-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
IF Staining of HaCaT using 87782-2-RR (same clone as 87782-2-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HaCaT using 87782-2-RR (same clone as 87782-2-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed HaCaT cells using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 87782-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP03201-1
The mean Claudin 1 concentration was determined to be 2.2 ng/mL in A431 cell extract based on a 1.5 mg/mL extract load, 15.2 ng/mL in A549 cell extract based on a 1.2 mg/mL extract load, HCT-116 cell extract were served as a negative control.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP03201-1
Cytometric bead array standard curve of MP03201-1, Claudin 1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87782-2-PBS. Detection antibody: 87782-1-PBS. Standard: Ag29269. Range: 0.312-40 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

87782-2-PBS targets Claudin 1 as part of a matched antibody pair:

MP03201-1: 87782-2-PBS capture and 87782-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag29269 Product name: Recombinant human Claudin 1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 102-211 aa of BC012471 Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV Predict reactive species
Full Name	claudin 1
Calculated Molecular Weight	211 aa, 23 kDa
Observed Molecular Weight	20-23 kDa
GenBank Accession Number	BC012471
Gene Symbol	Claudin 1
Gene ID (NCBI)	9076
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O95832
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 Claudins have been identified. They are small (20-27 kilodaltons (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier.