Claudin 1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Claudin 1 Recombinant monoclonal antibody (87782-2-RR)

Claudin 1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 87782-2-RR

Clone No.253345A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

Caudin 1, CLDN1, Claudin-1, CLD1, ILVASC

• 

  WB analysis of HT-29 using 87782-2-RR

  HT-29 cells were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87782-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87782-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87782-2-RR (Claudin 1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 87782-2-RR

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 87782-2-RR (Claudin 1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin using 87782-2-RR

  Immunohistochemical analysis of paraffin-embedded human skin tissue slide using 87782-2-RR (Claudin 1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat colon using 87782-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse colon using 87782-2-RR

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse colon tissue using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HaCaT using 87782-2-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HaCaT using 87782-2-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HaCaT cells using Claudin 1 antibody (87782-2-RR, Clone: 253345A9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HepG2 cells, HT-29 cells, mouse colon tissue, A549 cells, A431 cells, mouse skin tissue, rat skin tissue, rat colon tissue
• Positive IHC detected in: human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat colon tissue, mouse colon tissue
• Positive IF/ICC detected in: HaCaT cells

Freshly prepared samples are recommended.

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)-P: IF-P : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87782-2-RR targets Claudin 1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29269

  Product name: Recombinant human Claudin 1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-211 aa of BC012471

  Sequence: MKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWYGNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

• Full Name: claudin 1
• Calculated Molecular Weight: 211 aa, 23 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC012471
• Gene Symbol: Claudin 1
• Gene ID (NCBI): 9076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95832
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Claudins are a family of proteins that are the most important components of the tight junctions, where they establish the paracellular barrier that controls the flow of molecules in the intercellular space between the cells of an epithelium. 23 Claudins have been identified. They are small (20-27 kilodaltons (kDa)) proteins with similar structures. They have four transmembrane domains, with the N-terminus and the C-terminus in the cytoplasm. Claudin-1 is an integral membrane protein expressed primarily in keratinocytes and normal mammary epithelial cells. Claudin 1 forms tight junctions with other claudin proteins and plays an important role in the intestinal epithelial barrier.