Product Information
87812-3-PBS targets CHCHD10 as part of a matched antibody pair:
MP03220-1: 87812-2-PBS capture and 87812-3-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag22598 Product name: Recombinant human CHCHD10 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 82-142 aa of BC065232 Sequence: QPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLSLCEGFSEALKQCKYYHGLSSLP Predict reactive species |
| Full Name | coiled-coil-helix-coiled-coil-helix domain containing 10 |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14-18 kDa |
| GenBank Accession Number | BC065232 |
| Gene Symbol | CHCHD10 |
| Gene ID (NCBI) | 400916 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q8WYQ3 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CHCHD10 is a mitochondrial protein that is enriched at cristae junctions in the intermembrane space and is likely involved in mitochondrial genome stability and maintenance of cristae junctions. Mutations in CHCHD10 have recently been described as a cause of frontotemporal dementia (FTD) comorbid with amyotrophic lateral sclerosis (ALS).
