Use Able AI chat for product recommendations
  • KD/KO Validated

TCF4 Recombinant monoclonal antibody

TCF4 Uni-rAb® Recombinant Antibody for WB, ELISA

Cat No. 87884-1-RR
Clone No.253344F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

bHLHb19, Class B basic helix-loop-helix protein 19, E2 2, ITF 2, ITF2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, Caco-2 cells, K-562 cells, Neuro-2a cells, PC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87884-1-RR targets TCF4 in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17813

Product name: Recombinant human TCF4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 407-560 aa of BC125084

Sequence: PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE

Predict reactive species
Full Name transcription factor 4
Calculated Molecular Weight 671 aa, 72 kDa
Observed Molecular Weight 70-80 kDa, 65 kDa
GenBank Accession NumberBC125084
Gene Symbol TCF4
Gene ID (NCBI) 6925
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP15884
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transcription factor 4 (TCF4), also known as SEF2, ITF2, E2-2, and ME2, binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription By similarity. Human TCF4 mRNA expression is particularly high in the brain. Usage of numerous 5' exons of the human TCF4 gene potentially yields in TCF4 protein isoforms with 18 different N-termini. In addition, the diversity of isoforms is increased by alternative splicing of several internal exons. Some isoforms contain a bipartite nuclear localization signal and are exclusively nuclear, whereas distribution of other isoforms relies on heterodimerization partners. Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.TCF4 has several splicing isoforms that are expressed differentially in tissues and during cancer progression(15547706, 12796377). The scopel of molecular weight of several isoforms is about 60-90 kDa (21789225).

Protocols

Product Specific Protocols
WB protocol for TCF4 antibody 87884-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...