TCF4 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• TCF4 Recombinant monoclonal antibody, PBS Only (87884-1-PBS)

TCF4 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87884-1-PBS

Clone No.253344F9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

bHLHb19, Class B basic helix-loop-helix protein 19, E2 2, ITF 2, ITF2

• 

  WB analysis using 87884-1-RR (same clone as 87884-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87884-1-RR (TCF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87884-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Caco-2 using 87884-1-RR (same clone as 87884-1-PBS)

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 87884-1-RR (TCF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87884-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 87884-1-RR (same clone as 87884-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87884-1-RR (TCF4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87884-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 87884-1-RR (same clone as 87884-1-PBS)

  WB result of TCF4 antibody (87884-1-RR; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TCF4 transfected K-562 cells. This data was developed using the same antibody clone with 87884-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87884-1-PBS targets TCF4 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17813

  Product name: Recombinant human TCF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 407-560 aa of BC125084

  Sequence: PSTAMPGGHGDMHGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQDTKSSEDKKLDDDKKDIKSITRSRSSNNDDEDLTPE

• Full Name: transcription factor 4
• Calculated Molecular Weight: 671 aa, 72 kDa
• Observed Molecular Weight: 70-80 kDa, 65 kDa
• GenBank Accession Number: BC125084
• Gene Symbol: TCF4
• Gene ID (NCBI): 6925
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P15884
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Transcription factor 4 (TCF4), also known as SEF2, ITF2, E2-2, and ME2, binds to the immunoglobulin enchancer Mu-E5/KE5-motif. Involved in the initiation of neuronal differentiation. Activates transcription by binding to the E box (5'-CANNTG-3'). Binds to the E-box present in the somatostatin receptor 2 initiator element (SSTR2-INR) to activate transcription By similarity. Human TCF4 mRNA expression is particularly high in the brain. Usage of numerous 5' exons of the human TCF4 gene potentially yields in TCF4 protein isoforms with 18 different N-termini. In addition, the diversity of isoforms is increased by alternative splicing of several internal exons. Some isoforms contain a bipartite nuclear localization signal and are exclusively nuclear, whereas distribution of other isoforms relies on heterodimerization partners. Preferentially binds to either 5'-ACANNTGT-3' or 5'-CCANNTGG-3'.TCF4 has several splicing isoforms that are expressed differentially in tissues and during cancer progression(15547706, 12796377). The scopel of molecular weight of several isoforms is about 60-90 kDa (21789225).