Home
Products
Primary Antibodies
Recombinant Antibodies
PLAC8 Recombinant monoclonal antibody (87918-1-RR)

PLAC8 Recombinant monoclonal antibody

PLAC8 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87918-1-RR

Clone No.260137F8

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

BM-004, C15, onzin, placenta 8, Placenta-specific gene 8 protein

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICC

WB analysis using 87918-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 87918-1-RR (PLAC8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of THP-1 using 87918-1-RR
Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using PLAC8 antibody (87918-1-RR, Clone: 260137F8 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	PANC-1 cells, LoVo cells, HL-60 cells, THP-1 cells
Positive IF/ICC detected in	THP-1 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

87918-1-RR targets PLAC8 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag2939 Product name: Recombinant human PLAC8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC012205 Sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF Predict reactive species
Full Name	placenta-specific 8
Calculated Molecular Weight	12 kDa
Observed Molecular Weight	12 kDa
GenBank Accession Number	BC012205
Gene Symbol	PLAC8
Gene ID (NCBI)	51316
RRID	AB_3745826
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q9NZF1
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLAC8, also named as Protein C15, is a placenta-specific protein. The expression was downregulated upon activation, particularly in dendritic cells generated in vitro from CD34 (142230) progenitor cells. PLAC8 is specifically expressedin the interstitial extravillous trophoblast cells on the fetomaternal interface, while its expression is hardly detectable in the endovasculare trophoblast cells. The MW of PLAC8 is about 12-20 kDa.