PLAC8 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PLAC8 Recombinant monoclonal antibody, PBS Only (87918-1-PBS)

PLAC8 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87918-1-PBS

Clone No.260137F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

BM-004, C15, onzin, placenta 8, Placenta-specific gene 8 protein

• 

  WB analysis using 87918-1-RR (same clone as 87918-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87918-1-RR (PLAC8 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87918-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

87918-1-PBS targets PLAC8 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2939

  Product name: Recombinant human PLAC8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-115 aa of BC012205

  Sequence: MQAQAPVVVVTQPGVGPGPAPQNSNWQTGMCDCFSDCGVCLCGTFCFPCLGCQVAADMNECCLCGTSVAMRTLYRTRYGIPGSICDDYMATLCCPHCTLCQIKRDINRRRAMRTF

• Full Name: placenta-specific 8
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC012205
• Gene Symbol: PLAC8
• Gene ID (NCBI): 51316
• RRID: AB_3745826
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZF1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLAC8, also named as Protein C15, is a placenta-specific protein. The expression was downregulated upon activation, particularly in dendritic cells generated in vitro from CD34 (142230) progenitor cells. PLAC8 is specifically expressedin the interstitial extravillous trophoblast cells on the fetomaternal interface, while its expression is hardly detectable in the endovasculare trophoblast cells. The MW of PLAC8 is about 12-20 kDa.