Home
Products
Primary Antibodies
Recombinant Antibodies
SLC6A8 Recombinant monoclonal antibody (88049-1-RR)

SLC6A8 Recombinant monoclonal antibody

SLC6A8 Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 88049-1-RR

Clone No. 260302B8

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Creatine transporter 1, CRT, CRTR, CT1, Sodium- and chloride-dependent creatine transporter 1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCAffinity

WB analysis of rat kidney using 88049-1-RR
rat kidney tissue were subjected to SDS PAGE followed by western blot with 88049-1-RR (SLC6A8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 88049-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 88049-1-RR (SLC6A8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 88049-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 88049-1-RR (SLC6A8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 88049-1-RR
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 88049-1-RR (SLC6A8 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 88049-1-RR
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 88049-1-RR (SLC6A8 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity of 88049-1-RR
Biolayer interferometry (BLI) kinetic assays of 88049-1-RR against Human SLC6A8 were performed. The affinity constant is 3.83 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SLC6A8 in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	rat kidney tissue, mouse heart tissue, mouse kidney tissue, rat heart tissue
Positive IHC detected in	human liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunohistochemistry (IHC)	IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88049-1-RR targets SLC6A8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag14500 Product name: Recombinant human SLC6A8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 541-635 aa of BC012355 Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM Predict reactive species
Full Name	solute carrier family 6 (neurotransmitter transporter, creatine), member 8
Calculated Molecular Weight	635 aa, 71 kDa
Observed Molecular Weight	65-75 kDa
GenBank Accession Number	BC012355
Gene Symbol	SLC6A8
Gene ID (NCBI)	6535
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P48029
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020). The 75 kDa band is a glycosylated modified form.