SLC6A8 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• SLC6A8 Recombinant monoclonal antibody, PBS Only (88049-1-PBS)

SLC6A8 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 88049-1-PBS

Clone No.260302B8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

Creatine transporter 1, CRT, CRTR, CT1, Sodium- and chloride-dependent creatine transporter 1

• 

  WB analysis of rat kidney using 88049-1-RR (same clone as 88049-1-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 88049-1-RR (SLC6A8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88049-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88049-1-RR (same clone as 88049-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88049-1-RR (SLC6A8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88049-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 88049-1-RR (same clone as 88049-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88049-1-RR (SLC6A8 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88049-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88049-1-PBS targets SLC6A8 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag14500

  Product name: Recombinant human SLC6A8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 541-635 aa of BC012355

  Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM

• Full Name: solute carrier family 6 (neurotransmitter transporter, creatine), member 8
• Calculated Molecular Weight: 635 aa, 71 kDa
• Observed Molecular Weight: 65-75 kDa
• GenBank Accession Number: BC012355
• Gene Symbol: SLC6A8
• Gene ID (NCBI): 6535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P48029
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020). The 75 kDa band is a glycosylated modified form.