Use Able AI chat for product recommendations

SUB1 Recombinant monoclonal antibody, PBS Only (Detector)

SUB1 Uni-rAb® Recombinant Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 88052-1-PBS
Clone No.260206C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

Activated RNA polymerase II transcriptional coactivator p15, p14, P15, PC4, Positive cofactor 4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

88052-1-PBS targets SUB1 as part of a matched antibody pair:

MP03355-2: 88052-3-PBS capture and 88052-1-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1390

Product name: Recombinant human SUB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-127 aa of BC009610

Sequence: MPKSKELVSSGSSGSDSDSEVDKKLKRKKQVAPEKPVKKQKTGETSRALSSSKQSSSSRDDNMFQIGKMRYVSVRDFKGKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISDIDDAVRKL

Predict reactive species
Full Name SUB1 homolog (S. cerevisiae)
Calculated Molecular Weight 14 kDa
Observed Molecular Weight18-20 kDa
GenBank Accession NumberBC009610
Gene Symbol SUB1
Gene ID (NCBI) 10923
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP53999
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SUB1 gene encodes activated RNA polymerase II transcriptional coactivator p15, also termed as positive cofactor 4 (PC4) or p14. SUB1 is a sort of general coactivator that functions in assembling and stablization of transcription complex. It has DNA binding activity and is localized in the nucleus, mulitple modification sites of phosphorylation or acetylation may turn it appear slightly shifted molecular weight.

Loading...
||
New chat

Able

正在加载,请稍候...