Home
Products
Primary Antibodies
Recombinant Antibodies
S100A1 Recombinant monoclonal antibody (88164-1-RR)

S100A1 Recombinant monoclonal antibody

S100A1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 88164-1-RR

Clone No.252961A11

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Protein S100 A1, Protein S100-A1, S 100 protein alpha chain, S 100 protein subunit alpha, S100 calcium-binding protein A1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis using 88164-1-RR
Various lysates were subjected to SDS PAGE followed by western blot with 88164-1-RR (S100A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 88164-1-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 88164-1-RR (S100A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 88164-1-RR
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 88164-1-RR (S100A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of A375 using 88164-1-RR
Immunofluorescent analysis of (-20°C Methanol) fixed A375 cells using S100A1 antibody (88164-1-RR, Clone: 252961A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse heart tissue, human heart tissue
Positive IHC detected in	human tonsillitis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	A375 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:2000-1:10000
Immunohistochemistry (IHC)	IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88164-1-RR targets S100A1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag8871 Product name: Recombinant human S100A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC014392 Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS Predict reactive species
Full Name	S100 calcium binding protein A1
Calculated Molecular Weight	94 aa, 11 kDa
Observed Molecular Weight	10 kDa
GenBank Accession Number	BC014392
Gene Symbol	S100A1
Gene ID (NCBI)	6271
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P23297
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100A1 belongs to the S100 protein family, which represents the largest group among EF-hand Ca2+-binding proteins exclusively expressed in vertebrates. S100 proteins have been described as central regulators of numerous cellular and molecular processes, often operating in a cell-type-specific manner (PMID: 11991838). S100A1 is a central regulator of Ca2+-driven networks that orchestrates compartmentalized Ca2+ fluxes in the heart (PMID: 22336719, PMID: 26021637). S100A1 is primarily expressed in cardiomyocytes (CM). Endothelial cells (EC) express significantly lower S100A1 levels, whereas fibroblasts do not express S100A1 (PMID: 38641766).

Protocols

Product Specific Protocols
IF protocol for S100A1 antibody 88164-1-RR	Download protocol
IHC protocol for S100A1 antibody 88164-1-RR	Download protocol
WB protocol for S100A1 antibody 88164-1-RR	Download protocol