S100A1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• S100A1 Recombinant monoclonal antibody, PBS Only (88164-1-PBS)

S100A1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 88164-1-PBS

Clone No.252961A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Protein S100 A1, Protein S100-A1, S 100 protein alpha chain, S 100 protein subunit alpha, S100 calcium-binding protein A1

• 

  WB analysis using 88164-1-RR (same clone as 88164-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88164-1-RR (S100A1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88164-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 88164-1-RR (same clone as 88164-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 88164-1-RR (S100A1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88164-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 88164-1-RR (same clone as 88164-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 88164-1-RR (S100A1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88164-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A375 using 88164-1-RR (same clone as 88164-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A375 cells using S100A1 antibody (88164-1-RR, Clone: 252961A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 88164-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88164-1-PBS targets S100A1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8871

  Product name: Recombinant human S100A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-94 aa of BC014392

  Sequence: MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS

• Full Name: S100 calcium binding protein A1
• Calculated Molecular Weight: 94 aa, 11 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC014392
• Gene Symbol: S100A1
• Gene ID (NCBI): 6271
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23297
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

S100A1 belongs to the S100 protein family, which represents the largest group among EF-hand Ca2+-binding proteins exclusively expressed in vertebrates. S100 proteins have been described as central regulators of numerous cellular and molecular processes, often operating in a cell-type-specific manner (PMID: 11991838). S100A1 is a central regulator of Ca2+-driven networks that orchestrates compartmentalized Ca2+ fluxes in the heart (PMID: 22336719, PMID: 26021637). S100A1 is primarily expressed in cardiomyocytes (CM). Endothelial cells (EC) express significantly lower S100A1 levels, whereas fibroblasts do not express S100A1 (PMID: 38641766).