Home
Products
Primary Antibodies
Recombinant Antibodies
MPIG6B Recombinant monoclonal antibody, PBS Only (Capture) (88167-2-PBS)

Filter: AllWBSandwich ELISA sample testSandwich ELISAIPCytometric bead array sample testCytometric bead array

WB analysis using 88167-2-RR (same clone as 88167-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 88167-2-RR (G6B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88167-2-PBS in a different storage buffer formulation.
Sandwich ELISA sample test of MP03352-2
The mean MPIG6B concentration was determined to be 2.2 ng/mL in K-562 cell extract based on a 1.2 mg/mL extract load, 5.8 ng/mL in HEL cell extract based on a 1.5 mg/mL extract load, 1.1 ng/mL in 786-O cell extract based on a 1.2 mg/mL extract load, 2.4 ng/mL in THP-1 cell extract based on a 1.5 mg/mL extract load and 1.1 ng/mL in RT-4 cell extract based on a 1.5 mg/mL extract load.
Sandwich ELISA standard curve of MP03352-2
Sandwich ELISA standard curve of MP03352-2, Human MPIG6B Recombinant Matched Antibody Pair - PBS only. 88167-2-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg5762. 88167-3-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.
IP experiment of human peripheral blood platelets using 88167-2-RR (same clone as 88167-2-PBS)
IP result of anti-MPIG6B (IP:88167-2-RR, 4ug; Detection:88167-2-RR 1:3000) with human peripheral blood platelets lysate 880 ug. This data was developed using the same antibody clone with 88167-2-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP03352-1
The mean MPIG6B concentration was determined to be 8.8 ng/mL in HEL cell extract based on a 1.5 mg/mL extract load, THP-1 cell extract were served as a negative control.
Cytometric bead array standard curve of MP03352-1
Cytometric bead array standard curve of MP03352-1, MPIG6B Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88167-2-PBS. Detection antibody: 88167-1-PBS. Standard: Eg5762. Range: 0.156-20 ng/mL.

MPIG6B Recombinant monoclonal antibody, PBS Only (Capture)

Name: MPIG6B Recombinant monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 88167-2-PBS-100UG

MPIG6B Uni-rAb^® Recombinant Antibody for WB, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 88167-2-PBS

Clone No.260393F2

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

C6orf25, G6B, G6B-B, Megakaryocyte and platelet inhibitory receptor G6b, NG31

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

88167-2-PBS targets MPIG6B as part of a matched antibody pair:

MP03352-1: 88167-2-PBS capture and 88167-1-PBS detection (validated in Cytometric bead array)

MP03352-2: 88167-2-PBS capture and 88167-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg5762 Product name: Recombinant human G6B protein Source: mammalian cells-derived, V37 Tag: C-rFc Domain: 18-142 aa of NM_138272.3 Sequence: NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ Predict reactive species
Full Name	chromosome 6 open reading frame 25
Calculated Molecular Weight	26 kDa
Observed Molecular Weight	17kDa, 26 kDa
GenBank Accession Number	NM_138272.3
Gene Symbol	C6orf25
Gene ID (NCBI)	80739
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O95866-1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

MPIG6B (Megakaryocyte and Platelet Inhibitory Receptor G6b), also known as G6b-B or C6orf25, is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily, and serves as a key negative regulatory receptor for platelet activation and megakaryocyte differentiation. The intracellular domain of MPIG6B contains immunoreceptor tyrosine-based inhibitory motifs (ITIMs), which recruit SHP-1/SHP-2 phosphatases to inhibit Src family kinase activity, thereby negatively regulating platelet aggregation, release reactions, and megakaryocyte maturation. Mutations in the MPIG6B gene lead to thrombocytopenia and bleeding tendency, and its functional dysregulation is associated with immune thrombocytopenia (ITP) and myeloproliferative neoplasms.