MPIG6B Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• MPIG6B Recombinant monoclonal antibody (88167-2-RR)

• 

  WB analysis using 88167-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88167-2-RR (G6B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of human peripheral blood platelets using 88167-2-RR

  IP result of anti-MPIG6B (IP:88167-2-RR, 4ug; Detection:88167-2-RR 1:3000) with human peripheral blood platelets lysate 880 ug.

MPIG6B Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 88167-2-RR

Clone No.260393F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, ELISA

Synonyms

C6orf25, G6B, G6B-B, Megakaryocyte and platelet inhibitory receptor G6b, NG31

---

Tested Applications

• Positive WB detected in: human peripheral blood platelets
• Positive IP detected in: human peripheral blood platelets

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88167-2-RR targets MPIG6B in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5762

  Product name: Recombinant human G6B protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 18-142 aa of NM_138272.3

  Sequence: NPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFPACKGLSKGRRPILWASSSGTPTVPPLQPFVGRLRSLDSGIRRLELLLSAGDSGTFFCKGRHEDESRTVLHVLGDRTYCKAPGPTHGSVYPQ

• Full Name: chromosome 6 open reading frame 25
• Calculated Molecular Weight: 26 kDa
• Observed Molecular Weight: 17kDa, 26 kDa
• GenBank Accession Number: NM_138272.3
• Gene Symbol: C6orf25
• Gene ID (NCBI): 80739
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95866-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MPIG6B (Megakaryocyte and Platelet Inhibitory Receptor G6b), also known as G6b-B or C6orf25, is a type I transmembrane glycoprotein belonging to the immunoglobulin superfamily, and serves as a key negative regulatory receptor for platelet activation and megakaryocyte differentiation. The intracellular domain of MPIG6B contains immunoreceptor tyrosine-based inhibitory motifs (ITIMs), which recruit SHP-1/SHP-2 phosphatases to inhibit Src family kinase activity, thereby negatively regulating platelet aggregation, release reactions, and megakaryocyte maturation. Mutations in the MPIG6B gene lead to thrombocytopenia and bleeding tendency, and its functional dysregulation is associated with immune thrombocytopenia (ITP) and myeloproliferative neoplasms.