Home
Products
Primary Antibodies
Recombinant Antibodies
AKAP7 Recombinant monoclonal antibody (88409-2-RR)

AKAP7 Recombinant monoclonal antibody

AKAP7 Uni-rAb^® Recombinant Antibody for WB, IP, ELISA

Cat No. 88409-2-RR

Clone No.260933E6

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

A kinase anchor protein 18 kDa, AKAP 18, AKAP 7 isoforms alpha and beta, AKAP18, AKAP-7 isoforms alpha and beta

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIP

WB analysis using 88409-2-RR
Various lysates were subjected to SDS PAGE followed by western blot with 88409-2-RR (AKAP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of human brain using 88409-2-RR
IP result of anti-AKAP7 (IP:88409-2-RR, 4ug; Detection:88409-2-RR 1:1000) with human brain tissue lysate 1200 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse brain tissue, rat brain tissue, fetal human brain tissue
Positive IP detected in	human brain tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

88409-2-RR targets AKAP7 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag3297 Product name: Recombinant human AKAP7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-81 aa of BC016927 Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK Predict reactive species
Full Name	A kinase (PRKA) anchor protein 7
Calculated Molecular Weight	81 aa, 9 kDa
Observed Molecular Weight	9-15 kDa
GenBank Accession Number	BC016927
Gene Symbol	AKAP7
Gene ID (NCBI)	9465
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	O43687
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AKAP7, also named as AKAP15 and AKAP18, localize PKA in complexes with CaV1.2 and PLN, respectively. AKAP7 targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. AKAP7 has short isoform AKAP7 alpha and AKAP7 beta with MW 9-15 kDa; long isoform AKAP7 gamma with MW 37-42 kDa. AKAP7alpha was highly expressed only in brain and weakly in lung lysates from WT animals.