AKAP7 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• AKAP7 Recombinant monoclonal antibody, PBS Only (88409-2-PBS)

AKAP7 Uni-rAb^® Recombinant Antibody for WB, IP, Indirect ELISA

Cat No. 88409-2-PBS

Clone No.260933E6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

A kinase anchor protein 18 kDa, AKAP 18, AKAP 7 isoforms alpha and beta, AKAP18, AKAP-7 isoforms alpha and beta

• 

  WB analysis using 88409-2-RR (same clone as 88409-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88409-2-RR (AKAP7 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88409-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of human brain using 88409-2-RR (same clone as 88409-2-PBS)

  IP result of anti-AKAP7 (IP:88409-2-RR, 4ug; Detection:88409-2-RR 1:1000) with human brain tissue lysate 1200 ug. This data was developed using the same antibody clone with 88409-2-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88409-2-PBS targets AKAP7 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3297

  Product name: Recombinant human AKAP7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-81 aa of BC016927

  Sequence: MGQLCCFPFSRDEGKISEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK

• Full Name: A kinase (PRKA) anchor protein 7
• Calculated Molecular Weight: 81 aa, 9 kDa
• Observed Molecular Weight: 9-15 kDa
• GenBank Accession Number: BC016927
• Gene Symbol: AKAP7
• Gene ID (NCBI): 9465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O43687
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AKAP7, also named as AKAP15 and AKAP18, localize PKA in complexes with CaV1.2 and PLN, respectively. AKAP7 targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. AKAP7 has short isoform AKAP7 alpha and AKAP7 beta with MW 9-15 kDa; long isoform AKAP7 gamma with MW 37-42 kDa. AKAP7alpha was highly expressed only in brain and weakly in lung lysates from WT animals.