Tested Applications
| Positive WB detected in | HCT 116 cells, HeLa cells, MCF-7 cells, A375 cells, Jurkat cells |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
88445-1-RR targets CENPA in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25025 Product name: Recombinant human CENPA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC002703 Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH Predict reactive species |
| Full Name | centromere protein A |
| Calculated Molecular Weight | 16 kDa |
| Observed Molecular Weight | 16-20 kDa |
| GenBank Accession Number | BC002703 |
| Gene Symbol | CENPA |
| Gene ID (NCBI) | 1058 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P49450 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Centromere protein-A (CENP-A) is a Histone H3-like protein that contains a C-terminal H3-like domain, required for centro-mere localization of CENP-A, and an antigenic N-terminal domain. CENP-A, originally isolated from HeLa cells, is essential for kinetochore targeting of CENP-C. In the presence of DNA, CENP-A forms an octameric complex with histones H4, H2A and H2B. CENP-A specifically localizes to active centromeres and is a component of specialized centromeric nucleosomes, on which kinetochores are assembled. CENP-A is essential for nucleosomal packaging of centromeric DNA at interphase and functions as a centromere formation marker on the chromosome.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CENPA antibody 88445-1-RR | Download protocol |
| WB protocol for CENPA antibody 88445-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



