CENPA Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CENPA Recombinant monoclonal antibody, PBS Only (88445-1-PBS)

CENPA Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 88445-1-PBS

Clone No.260865G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CENP A, CENP-A, Histone H3-like centromeric protein A

• 

  WB analysis using 88445-1-RR (same clone as 88445-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88445-1-RR (CENPA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88445-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 88445-1-RR (same clone as 88445-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using CENPA antibody (88445-1-RR, Clone: 260865G5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red). This data was developed using the same antibody clone with 88445-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88445-1-PBS targets CENPA in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25025

  Product name: Recombinant human CENPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC002703

  Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH

• Full Name: centromere protein A
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: BC002703
• Gene Symbol: CENPA
• Gene ID (NCBI): 1058
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49450
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Centromere protein-A (CENP-A) is a Histone H3-like protein that contains a C-terminal H3-like domain, required for centro-mere localization of CENP-A, and an antigenic N-terminal domain. CENP-A, originally isolated from HeLa cells, is essential for kinetochore targeting of CENP-C. In the presence of DNA, CENP-A forms an octameric complex with histones H4, H2A and H2B. CENP-A specifically localizes to active centromeres and is a component of specialized centromeric nucleosomes, on which kinetochores are assembled. CENP-A is essential for nucleosomal packaging of centromeric DNA at interphase and functions as a centromere formation marker on the chromosome.