Home
Products
Primary Antibodies
Recombinant Antibodies
Calbindin-D28k Recombinant monoclonal antibody, PBS Only (Detector) (88615-1-PBS)

Calbindin-D28k Recombinant monoclonal antibody, PBS Only (Detector)

Name: Calbindin-D28k Recombinant monoclonal antibody, PBS Only (Detector), 100ug
Brand: Proteintech
SKU: 88615-1-PBS-100UG

Calbindin-D28k Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 88615-1-PBS

Clone No. 261340A1

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Synonyms

CALB1, Calbindin, CALB, calbindin 1, 28kDa, Calbindin D28

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-PCytometric bead array sample testCytometric bead arrayAffinity

WB analysis using 88615-1-RR (same clone as 88615-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 88615-1-RR (Calbindin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse cerebellum using 88615-1-RR (same clone as 88615-1-PBS)
mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 88615-1-RR (Calbindin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of pig brain using 88615-1-RR (same clone as 88615-1-PBS)
pig brain tissue were subjected to SDS PAGE followed by western blot with 88615-1-RR (Calbindin antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat cerebellum using 88615-1-RR (same clone as 88615-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 88615-1-RR (Calbindin-D28k antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of rat cerebellum using 88615-1-RR (same clone as 88615-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 88615-1-RR (Calbindin-D28k antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 88615-1-RR (same clone as 88615-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 88615-1-RR (Calbindin-D28k antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse cerebellum using 88615-1-RR (same clone as 88615-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 88615-1-RR (Calbindin-D28k antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse cerebellum using 88615-1-RR (same clone as 88615-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using Calbindin-D28k antibody (88615-1-RR, Clone: 261340A1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using Calbindin-D28k antibody (88615-1-RR, Clone: 261340A1 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 88615-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP03605-1
The mean Calbindin-D28k concentration was determined to be 36.7 ng/mL in human urine .
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP03605-1
Cytometric bead array standard curve of MP03605-1, Calbindin-D28k Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88615-2-PBS. Detection antibody: 88615-1-PBS. Standard: Ag5861. Range: 0.469-60 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity of 88615-1-RR
Biolayer interferometry (BLI) kinetic assays of 88615-1-RR against Human Calbindin-D28k were performed. The affinity constant is 2.13 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Calbindin-D28k in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

88615-1-PBS targets Calbindin-D28k as part of a matched antibody pair:

MP03605-1: 88615-2-PBS capture and 88615-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 110-261 aa of BC006478 Sequence: YDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN Predict reactive species
Full Name	calbindin 1, 28kDa
Calculated Molecular Weight	30 kDa
Observed Molecular Weight	28 kDa
GenBank Accession Number	BC006478
Gene Symbol	Calbindin
Gene ID (NCBI)	793
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P05937
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine.