Product Information
88675-1-PBS targets EAAT2 as part of a matched antibody pair:
MP03768-1: 88675-2-PBS capture and 88675-1-PBS detection (validated in Sandwich ELISA)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag19816 Product name: Recombinant human SLC1A2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 460-574 aa of BC132768 Sequence: PTEDISLLVAVDWLLDRMRTSVNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKSADCSVEEEPWKREK Predict reactive species |
| Full Name | solute carrier family 1 (glial high affinity glutamate transporter), member 2 |
| Calculated Molecular Weight | 574 aa, 62 kDa |
| Observed Molecular Weight | 60-70 kDa |
| GenBank Accession Number | BC132768 |
| Gene Symbol | EAAT2 |
| Gene ID (NCBI) | 6506 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P43004 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
There are five isoforms of the EAATs, with their expression being cell type and brain region specific . The isoforms EAAT1 and EAAT2 are primarily expressed on astrocytes, with high expression in the cerebellum and throughout the entire brain, respectively. EAAT3 is expressed throughout the brain, while EAAT4 expression is predominantly found in the cerebellum. EAAT5 expression is mainly restricted to photoreceptors and bipolar cells in the retina. EAAT2, encoded by the SLC1A2 gene and also referred to by its rodent nomenclature, glutamate transporter 1 (GLT-1), is responsible for 90% of glutamate uptake in the mature brain. Its expression is hence critical for controlling extracellular glutamate concentrations.
