Home
Products
Primary Antibodies
Recombinant Antibodies
Gamma Catenin Recombinant monoclonal antibody, PBS Only (Detector) (88895-2-PBS)

Gamma Catenin Recombinant monoclonal antibody, PBS Only (Detector)

Name: Gamma Catenin Recombinant monoclonal antibody, PBS Only (Detector), 100ug
Brand: Proteintech
SKU: 88895-2-PBS-100UG

Gamma Catenin Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 88895-2-PBS

Clone No.261780E6

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, canine

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

Synonyms

JUP, JUP/gamma Catenin, γ-Catenin, ARVD12, Catenin gamma

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICCCytometric bead array sample testCytometric bead array

WB analysis using 88895-2-RR (same clone as 88895-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 88895-2-RR (JUP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88895-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 88895-2-RR (same clone as 88895-2-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 88895-2-RR (JUP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88895-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 88895-2-RR (same clone as 88895-2-PBS)
C2C12 cells lysates were subjected to SDS PAGE followed by western blot with 88895-2-RR (JUP antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88895-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HT-29 using 88895-2-RR (same clone as 88895-2-PBS)
Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using Gamma Catenin antibody (88895-2-RR, Clone: 261780E6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 88895-2-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array sample test of MP03731-1
The mean Gamma Catenin concentration was determined to be 145.6 ng/mL in A431 cell extract based on a 1.2 mg/mL extract load, 76.2 ng/mL in T-47D cell extract based on a 1.2 mg/mL extract load, 1.5 ng/mL in A-204 cell extract based on a 1.2 mg/mL extract load.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP03731-1
Cytometric bead array standard curve of MP03731-1, Gamma Catenin Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88895-3-PBS. Detection antibody: 88895-2-PBS. Standard: Ag1627. Range: 0.312-40 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

88895-2-PBS targets Gamma Catenin as part of a matched antibody pair:

MP03731-1: 88895-3-PBS capture and 88895-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, canine
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag1627 Product name: Recombinant human JUP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 396-745 aa of BC011865 Sequence: LVNQLSVDDVNVLTCATGTLSNLTCNNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNYGIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQRHVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENIQRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDYRKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDLDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA Predict reactive species
Full Name	junction plakoglobin
Calculated Molecular Weight	82 kDa
Observed Molecular Weight	82 kDa
GenBank Accession Number	BC011865
Gene Symbol	Gamma Catenin
Gene ID (NCBI)	3728
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P14923
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Plakoglobin (γ-catenin), a member of the Armadillo proteins, plays important roles in cell adhesion with α-catenin and β-catenin, is involved in Wnt signaling, and is translocated into the nucleus and binds LEF1. Plakoglobin is a major cytoplasmic component of both desmosomes and adherens junctions, and is the only known constituent common to submembranous plaques in both of these structures, which are located at the intercalated disc (ICD) of cardiomyocytes. Plakoglobin links cadherins to the actin cytoskeleton. Mutations in plakoglobin are associated with arrhythmogenic right ventricular dysplasia and Pemphigus vulgaris.