Home
Products
Primary Antibodies
Recombinant Antibodies
EIF4E Recombinant monoclonal antibody, PBS Only (Capture) (89091-1-PBS)

EIF4E Recombinant monoclonal antibody, PBS Only (Capture)

Name: EIF4E Recombinant monoclonal antibody, PBS Only (Capture), 100ug
Brand: Proteintech
SKU: 89091-1-PBS-100UG

EIF4E Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Cat No. 89091-1-PBS

Clone No. 262243C4

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

Synonyms

eIF 4E, eIF-4E, EIF4EL1, EIF4F, eIF-4F 25 kDa subunit

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIF/ICCFC (Intra)Cytometric bead array sample testCytometric bead arrayAffinity

WB analysis using 89091-1-RR (same clone as 89091-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 89091-1-RR (EIF4E antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 89091-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HSC-T6 using 89091-1-RR (same clone as 89091-1-PBS)
HSC-T6 cells were subjected to SDS PAGE followed by western blot with 89091-1-RR (EIF4E antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 89091-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 89091-1-RR (same clone as 89091-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using EIF4E antibody (89091-1-RR, Clone: 262243C4 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 89091-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HeLa using 89091-1-RR (same clone as 89091-1-PBS)
1x10^6 HeLa cells were intracellularly stained with 0.25 ug EIF4E Recombinant monoclonal antibody (89091-1-RR, Clone:262243C4)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 89091-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HeLa cells were intracellularly stained with 0.25 ug EIF4E Recombinant monoclonal antibody (89091-1-RR, Clone:262243C4)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Intracellular Flow Cytometry Fixation & Permeabilization Buffer Kit (PF00019). This data was developed using the same antibody clone with 89091-1-PBS in a different storage buffer formulation.
Cytometric bead array sample test of MP03801-1
The mean EIF4E concentration was determined to be 316 ng/mL in Ramos cell extract based on a 1.2 mg/mL extract load, 347.5 ng/mL in Raji cell extract based on a 1.2 mg/mL extract load, 130.6 ng/mL in 5637 cell extract based on a 1.2 mg/mL extract load.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Cytometric bead array standard curve of MP03801-1
Cytometric bead array standard curve of MP03801-1, EIF4E Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 89091-1-PBS. Detection antibody: 89091-3-PBS. Standard: Ag27191. Range: 0.312-40 ng/mL.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity of 89091-1-RR
Biolayer interferometry (BLI) kinetic assays of 89091-1-RR against Human EIF4E were performed. The affinity constant is below 1 pM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for EIF4E in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

89091-1-PBS targets EIF4E as part of a matched antibody pair:

MP03801-1: 89091-1-PBS capture and 89091-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag27191 Product name: Recombinant human EIF4E protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-217 aa of BC012611 Sequence: MATVEPETTPTPNPPTTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLNRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV Predict reactive species
Full Name	eukaryotic translation initiation factor 4E
Calculated Molecular Weight	29 kDa
Observed Molecular Weight	26-29 kDa
GenBank Accession Number	BC012611
Gene Symbol	EIF4E
Gene ID (NCBI)	1977
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P06730
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Eukaryotic translation initiation factor 4E, also known as eIF4E, is a protein that in humans is encoded by the EIF4E gene. eIF4E is the mRNA cap-binding protein, known as a general initiation factor allowing for mRNA-ribosome interaction and cap-dependent translation in eukaryotic cells. eIF4E is a polypeptide that exists as both a free form and as part of the eIF4F pre-initiation complex. Regulation of eIF4E may be achieved via three distinct mechanisms: transcription, phosphorylation, and inhibitory proteins. This is a rabbit polyclonal antibody raised against the full-length human EIF4E.