Anti-Human IL-12/IL-23 p40 Rabbit Recombinant Antibody

IL-12/IL-23 p40 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98277-1-RR
Clone No.241600F8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC (Intra)

IL12B, 241600F8, CLMF p40, Cytotoxic lymphocyte maturation factor 40 kDa subunit, IL 12 P40

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inIFN gamma, LPS and Brefeldin A treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98277-1-RR targets IL-12/IL-23 p40 in FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0431

Product name: Recombinant Human IL-12/IL-23 p40 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 23-328 aa of BC067498

Sequence: IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS

Predict reactive species
Full Name interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40)
Calculated Molecular Weight 328 aa, 37 kDa
GenBank Accession NumberBC067498
Gene Symbol IL12B
Gene ID (NCBI) 3593
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP29460
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

Interleukin (IL)-12 and IL-23 are heterodimeric cytokines that share a common p40 subunit (PMID: 11114383). IL-12 is composed of the IL-12 p40 subunit linked to the IL-12 p35 subunit, and the heterodimer signals through the IL-12 receptor (IL-12R), which comprises the IL-12Rβ1 and IL-12Rβ2 subunits. IL-23 is composed of the IL-23 p19 subunit and the IL-12 p40 (IL-12/23p40) subunit, which signals through IL-23R and IL-12Rβ1 (PMID: 11114383; 26121196 ). IL-12/IL-23 p40 also exists as a monomer and as a homodimer which can act as a potent IL-12 antagonist (PMID: 8958912; 18783467). IL-12/IL-23 p40 is produced by antigen-presenting cells, such as dendritic cells (DCs), monocytes, macrophages, neutrophils and, to a lesser extent, B cells (PMID: 20476918).

Protocols

Product Specific Protocols
FC protocol for IL-12/IL-23 p40 antibody 98277-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...