Home
Products
Primary Antibodies
Flow Cytometry Antibodies
Anti-Rat IL-1 beta Rabbit Recombinant Antibody (98310-2-RR)

Anti-Rat IL-1 beta Rabbit Recombinant Antibody

IL-1 beta Uni-rAb^® Recombinant Antibody for FC (Intra)

Cat No. 98310-2-RR

Clone No. 241001F11

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

FC (Intra)

Synonyms

Il1 beta, Il1b, IL 1 beta, IL-1 beta,IL 1 beta,IL1beta, IL-1 β

Formulation: PBS, Azide

PBS, Azide

PBS Only

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllFC (Intra)

FC experiment of Transfected HEK-293T using 98310-2-RR
1x10^6 HEK-293T cells or IL-1 beta transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat Il1 beta Rabbit RecAb (98310-2-RR, Clone: 241001F11) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of Transfected HEK-293T using 98310-2-RR
1x10^6 HEK-293T cells or IL-1 beta transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat Il1 beta Rabbit RecAb (98310-2-RR, Clone: 241001F11) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005) (red), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
×
1x10^6 HEK-293T cells or IL-1 beta transfected HEK-293T cells were intracellularly stained with 0.25 ug Anti-Rat Il1 beta Rabbit RecAb (98310-2-RR, Clone: 241001F11) and Multi-rAb CoraLite ® Plus 647-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR005) (red), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Able AI

What's the best dilution for IL-1 beta in ?

Overview

Tested Applications
Product Information
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive FC (Intra) detected in

Transfected HEK-293T cells

Recommended dilution

Application	Dilution
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98310-2-RR targets IL-1 beta in FC (Intra) applications and shows reactivity with rat samples.

Tested Reactivity	rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Eg31371 Product name: Recombinant Rat IL-1 beta protein (Myc Tag, His Tag) Source: mammalian cells-derived, pHZ-KIsec Tag: Myc & 6*His Domain: 117-268 aa of NM_031512 Sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS Predict reactive species
Full Name	interleukin 1 beta
Calculated Molecular Weight	31 kDa
GenBank Accession Number	NM_031512
Gene Symbol	IL-1 beta
Gene ID (NCBI)	24494
RRID	AB_3745969
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q63264
Storage Buffer	PBS with 0.09% sodium azide, pH 7.3.
Storage Conditions	Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Interleukin-1, produced mainly by blood monocytes, mediates the panoply of host reactions collectively known as acute phase response. It is identical to endogenous pyrogen. The multiple biologic activities that define IL1 are properties of a 15- to 18-kD protein that is derived from a 30- to 35-kD precursor. Interleukin 1β (IL-1B) is a member of the interleukin 1 cytokine family. It is a pro-inflammatory cytokine against infection, playing an important role in the pathogenesis of cancers. It signals through various adaptor proteins and kinases that lead to activation of numerous downstream targets.