Anti-Mouse CXCL4/PF4 Rabbit Recombinant Antibody

CXCL4/PF4 Uni-rAb® Recombinant Antibody for FC (Intra)
Cat No. 98397-2-RR
Clone No.242741F10

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC (Intra)

C-X-C motif chemokine 4, CXCL4, PF-4, Platelet factor 4

Formulation:  PBS, Azide
PBS, Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inTransfected HEK-293T cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

98397-2-RR targets CXCL4/PF4 in FC (Intra) applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg3345

Product name: Recombinant Mouse CXCL4/PF4 protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 30-105 aa of NM_019932

Sequence: VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES

Predict reactive species
Full Name platelet factor 4
Calculated Molecular Weight11kd
GenBank Accession NumberNM_019932
Gene Symbol Pf4
Gene ID (NCBI) 56744
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Z126
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2 - 8°C. Stable for one year after shipment.

Background Information

CXCL4, also known as platelet factor 4 (PF-4), is the oldest member of the chemokine family. CXCL4 is a chemokine produced by activated platelets and immune cells involved in pathological conditions such as cancer, infections and inflammatory diseases like systemic sclerosis (SSc), rheumatoid arthritis (RA) and psoriatic arthritis (PsA), among others. CXCL4 is present in the α-granules of platelets in amounts that constitute up to 2% platelet protein mass. CXCL4 plays a determinant role in distinct physiological processes such as in hematopoiesis, angiogenesis, coagulation and modulation of immune responses. For instance, CXCL4 can prevent monocyte apoptosis and promote cell survival, induces the production of TNF and reactive oxygen species (ROS) and promotes monocyte differentiation into a unique macrophage-like phenotype.

Protocols

Product Specific Protocols
FC protocol for CXCL4/PF4 antibody 98397-2-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...