ALOX15B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ALOX15B Polyclonal antibody, PBS Only (13073-1-PBS)

• 

  WB analysis of A431 using 13073-1-AP (same clone as 13073-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 13073-1-AP (15 Lipoxygenase 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13073-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 13073-1-AP (same clone as 13073-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13073-1-AP (15 Lipoxygenase 2 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13073-1-PBS in a different storage buffer formulation.

ALOX15B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13073-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

15 lipoxygenase 2, 15-LOX-2, 15-lipoxygenase 2, 15 LOX B, 15 LOX 2

---

Product Information

13073-1-PBS targets ALOX15B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3741

  Product name: Recombinant human ALOX15B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC035217

  Sequence: MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPEDVGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQEGTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAKNANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFASQFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKW

• Full Name: arachidonate 15-lipoxygenase, type B
• Calculated Molecular Weight: 676 aa, 76 kDa
• Observed Molecular Weight: 67-76 kDa
• GenBank Accession Number: BC035217
• Gene Symbol: ALOX15B
• Gene ID (NCBI): 247
• RRID: AB_2227031
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15296
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

In humans, there are 6 functional lipoxygenases genes. Two of them encode for arachidonic acid 12-lipoxygenating (ALOX12, ALOX12B) and two for 15-lipoxygenating enzymes (ALOX15, ALOX15B). ALOX15B has been described as the most abundant 15-lipoxygenating enzyme species in human carotid atherosclerotic lesions and to be associated with cerebrovascular symptoms. (PMID:24373925). ALOX15B has 4 isoforms produced by alternative splicing with the MW of 76, 67, 69 and 73 kDa. 13073-1-AP can also recognize the mouse Alox8 protein.