Glucagon Polyclonal antibody

Glucagon Polyclonal Antibody for IHC, IF-P, ELISA

Cat No. 15954-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, ELISA

GCG, GLP 2, GLP1, GLP2, glucagon, GRPP, GRPP Oxyntomodulin, OXM, Proglucagon

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman pancreas tissue, human small intestine tissue, mouse small intestine tissue, rat pancreas tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pancreas tissue, human pancreas tissue, rat pancreas tissue

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:12800-1:51200
Immunofluorescence (IF)-PIF-P : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15954-1-AP targets Glucagon in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8677

Product name: Recombinant human Glucagon protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC005278

Sequence: MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK

Predict reactive species
Full Name glucagon
Calculated Molecular Weight 180 aa, 21 kDa
GenBank Accession NumberBC005278
Gene Symbol Glucagon
Gene ID (NCBI) 2641
RRIDAB_2878200
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01275
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Background

Glucagon is a protein cleaved from a precursor protein encoded by the GCG gene. The distinct peptides formed from this precursor include Glucagon, Glucagon-Like Peptide 1 (GLP-1), Glucagon-Like Peptide 2 (GLP-2), and oxyntomodulin. Glucagon is essential in maintaining blood glucose homeostasis and therefore has a key role in Type 1 and Type 2 diabetes.

 What is the molecular weight of Glucagon?

21 kDa. Glucagon is composed of 180 amino acids and is a ligand for a specific G-protein coupled receptor (GPCR).

 Where is it expressed?

Glucagon is a hormone secreted by the pancreas, in the α cells of the islets of Langerhans (PMID: 18880761). GLP-1, GLP-2, and oxyntomodulin are secreted by gut endocrine cells of the GI tract and also by selected neurons in the brain. These secreted proteins are transported to the target organ in plasma.

 What is the function of glucagon?

The regulation of blood glucose levels is controlled by a balance of the hormones INS and glucagon in a negative feedback loop. A drop in blood glucose, or hypoglycemia, stimulates the release of glucagon. This initiates a cascade of signals, ultimately causing the conversion of stored glycogen into free glucose in a process called glycogenolysis, which takes place in liver and muscle cells. Glucagon can also stimulate gluconeogenesis in the liver, the process of forming glucose from non-carbohydrate sources such as amino acids (PMID: 13477815).

 What diseases are associated with glucagon?

Glucagon is key in homeostasis of blood glucose and maintaining the balance between hyperglycaemia and hypoglycemia. It is therefore important in the study of Type 1 and Type 2 diabetes mellitus, where dysfunction of the pancreatic cells leads to a deregulation of blood glucose levels (PMID: 19326096). In both forms of the disease, glucagon secretion is impaired, from too much being secreted during hyperglycaemia, to too little being released to normalize hypoglycemia (PMID: 18197838).


Protocols

Product Specific Protocols
IF protocol for Glucagon antibody 15954-1-APDownload protocol
IHC protocol for Glucagon antibody 15954-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle

Cell

Neuroendocrine cells orchestrate regeneration through Desert hedgehog signaling

Authors - William Kong
humanIF

Cell Metab

SARS-CoV-2 infects human pancreatic β cells and elicits β cell impairment.

Authors - Chien-Ting Wu
mouseIF

J Pineal Res

Paternal sleep deprivation induces metabolic perturbations in male offspring via altered LRP5 DNA methylation of pancreatic islets

Authors - Yi Zeng
mouseIF

J Cell Biol

VAMP4 regulates insulin levels by targeting secretory granules to lysosomes

Authors - Min Li
mouseIHC

Cell Rep

Spatiotemporal role of SETD2-H3K36me3 in murine pancreatic organogenesis

Authors - Ping Lu

Phytomedicine

Ramulus Mori (Sangzhi) alkaloids enhance pancreatic β-Cell maturation and function by targeting the CD81/endoplasmic reticulum stress pathway

Authors - Nan Wu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

MALLIKARJUNA (Verified Customer) (11-07-2025)

WORKS GOOD FOR WESTERN BLOT

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: liver tissue
FH

kk (Verified Customer) (11-21-2018)

very strong and specific staining in mouse pancreas tissues

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: mouse islets
Loading...
||
New chat

Able

正在加载,请稍候...