Tested Applications
| Positive WB detected in | HEK-293 cells, A549 cells, C6 cells, HeLa cells, mouse colon tissue, Caco-2 cells, RAW 264.7 cells, SMMC-7721 cells, HepG2 cells, Jurkat cells, mouse brain tissue, rat brain tissue, NIH/3T3 cells, mouse liver tissue, rat kidney tissue, rat spleen tissue, rat liver tissue |
| Positive IHC detected in | human colon tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:4000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20536-1-AP targets Beta Actin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine, monkey samples.
| Tested Reactivity | human, mouse, rat, canine, monkey |
| Cited Reactivity | canine, chicken, bovine, goat, fish, grouper, duck, camelus bactrianus, carp |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK Predict reactive species |
| Full Name | actin, beta |
| Calculated Molecular Weight | 375 aa, 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC002409 |
| Gene Symbol | Beta Actin |
| Gene ID (NCBI) | 60 |
| RRID | AB_10700003 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60709 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Beta Actin antibody 20536-1-AP | Download protocol |
| IHC protocol for Beta Actin antibody 20536-1-AP | Download protocol |
| WB protocol for Beta Actin antibody 20536-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Beta Actin Polyclonal Antibody (Cat# 20536-1-AP) has accumulated 6,387 citations in high-impact journals including Nature, Science, Cell, Cancer Cell, Immunity, Nature Communications, Autophagy, Redox Biology, and ACS Nano. Research fields span oncology (cancer metabolism, immunotherapy, drug resistance), neuroscience (Alzheimer's, Parkinson's, stroke), immunology (inflammation, innate immunity), autophagy and mitophagy, cardiovascular disease, diabetes, bone regeneration, virology, and tissue engineering. The antibody is predominantly used as a loading control in Western blotting across human, mouse, and rat studies.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Cannabis suppresses antitumor immunity by inhibiting JAK/STAT signaling in T cells through CNR2. | ||
Signal Transduct Target Ther Identifying genetic targets in clinical subtypes of Parkinson's disease for optimizing pharmacological treatment strategies | ||
Signal Transduct Target Ther Acevaltrate as a novel ferroptosis inducer with dual targets of PCBP1/2 and GPX4 in colorectal cancer | ||
Cancer Cell Pericancerous cross-presentation to cytotoxic T lymphocytes impairs immunotherapeutic efficacy in hepatocellular carcinoma | ||
Cancer Cell Targeting the immune privilege of tumor-initiating cells to enhance cancer immunotherapy | ||
Reviews
What customers say
Users consistently rate this antibody highly (mostly 5 stars) for Western Blot as a housekeeping/normalization control. Reviewers report strong, specific bands at 1:1000 dilution across human, mouse, and rat samples, including cell lines, tissues, and post-mortem material. It is praised for reliability in routine experiments and even works at lower concentrations (1:10000). The only noted drawback is that it can be difficult to strip from membranes. Overall, users recommend it as a dependable loading control for Western blotting.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (03-24-2026) | Great Saviour for our research projects to validate all the cell lines!
|
Sai Sindhura (Verified Customer) (01-08-2026) |
|
Shivam (Verified Customer) (01-02-2026) | prominent bands. Very few unspecific binding.
|
Matthieu (Verified Customer) (09-24-2025) | Produces a clear band in WB at the expected molecular weight
|
Manon (Verified Customer) (09-17-2025) | Very good housekeeping antibody
|
YINGJIAN (Verified Customer) (05-27-2025) | This primary antibody is effective, even at a low concentration (1:10000).
 |
Julia (Verified Customer) (06-20-2023) | Our lab has been using Proteintech's beta actin polyclonal antibody for years. We use this antibody in all our western blot experiments for normalization. This antibody works consistently at a 1:1000 dilution for human and mouse retina and for HRECs. We have always gotten a beautiful result, with nice thick and specific bands. The only downside is that this antibody is hard to strip. Even after stripping, the membrane tends to have residual beta actin bands. Even so, we would highly recommend this product for routine western blots.
 |
Chun (Verified Customer) (06-19-2022) | This antibody worked very well.
|
Aaron (Verified Customer) (12-08-2020) | nice bands achieved
|
Wei (Verified Customer) (01-30-2020) | Strong, clear band for basal heart tissues.Good for internal control for heart diseases.
|
SCOTT (Verified Customer) (10-11-2019) | Used 1/1000 overnight 4 C. overnightHuman Grey matter cortex post mortem material
 |
Dan (Verified Customer) (08-19-2019) | The antibody works
|
Kishor (Verified Customer) (01-30-2019) | Working well for Western Blotting (1:5000)
 |
