BIM/BCL2L11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• BIM/BCL2L11 Polyclonal antibody (22037-1-AP)

Bim Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22037-1-AP Copied!

Publications (34)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

BAM, BCL2L11, BIM, BIM alpha6, BIM beta6, BIM beta7, BimEL, BimL, BOD

• 

  WB analysis using 22037-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 22037-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 22037-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 22037-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 22037-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 22037-1-AP (BIM, BCL2L11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Bim in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, Raji cells
• Positive IHC detected in: human breast cancer tissue, human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22037-1-AP targets Bim in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11875

  Product name: Recombinant human BIM, BCL2L11 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-198 aa of BC033694

  Sequence: MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH

• Full Name: BCL2-like 11 (apoptosis facilitator)
• Calculated Molecular Weight: 198 aa, 22 kDa
• Observed Molecular Weight: 23 and 18 kDa
• GenBank Accession Number: BC033694
• Gene Symbol: Bim
• Gene ID (NCBI): 10018
• RRID: AB_2878978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43521
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The BIM/BCL2L11 polyclonal antibody (Cat# 22037-1-AP) has accumulated 34 citations published in journals such as Molecular Cell, Cell Reports, Cell Death Discovery, Advanced Materials, Advanced Science, Biochemical Pharmacology, Frontiers in Pharmacology, Journal of Investigative Dermatology, and Onco Targets & Therapy. Associated research fields include apoptosis, autophagy, multiple cancer types (lung, breast, gastric, cervical, thyroid, glioma), drug resistance mechanisms, neurodegeneration, radiation tissue damage, and intervertebral disc degeneration.

Automatically generated from the 34 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Mater; Selective Organ-Targeting Hafnium Oxide Nanoparticles with Multienzyme-Mimetic Activities Attenuate Radiation-Induced Tissue Damage; Authors - Dingxin Liu
human	WB	Drug Resist Updat; TRIM24 promotes T-cell lymphoma development and glucocorticoid resistance via FUS-mediated phase separation of the glucocorticoid receptor; Authors - Chen Wang
human	WB	Mol Cell; Filamentous GLS1 promotes ROS-induced apoptosis upon glutamine deprivation via insufficient asparagine synthesis.; Authors - Bin Jiang
rat	WB	J Nanobiotechnology; Synergistic microenvironment therapy: a dual-function nanogel of supramolecular collagen ll-mimetic matrix and antioxidant MXene for attenuating intervertebral disc degeneration.; Authors - Gan Lyu
		Adv Sci (Weinh); EGFR Targeted Liposomal PROTAC Assisted With Epigenetic Regulation as an Efficient Strategy for Osimertinib-Resistant Lung Cancer Therapy; Authors - Dongyuan Wang
human, mouse	WB	Cell Rep Med; FBXO3-mediated DUSP9 ubiquitination promotes leukemia stem cell maintenance and tyrosine kinase inhibitor resistance in chronic myeloid leukemia.; Authors - Xudong Li