4-1BBL/TNFSF9 Monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 66450-1-Ig (same clone as 66450-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66450-1-Ig (4-1BBL/TNFSF9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66450-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA standard curve of MP50011-1

  Sandwich ELISA standard curve of MP50011-1, 4-1BBL/TNFSF9 Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66450-1-PBS. Detection antibody: HRP-conjugated 66450-2-PBS. Standard: Ag12768. Range: 0.313-20 ng/mL.

• Featured Product
• KD/KO Validated

4-1BBL/TNFSF9 Monoclonal Antibody for WB, Sandwich ELISA, Indirect ELISA

Cat No. 66450-1-PBS

Clone No.1B4B1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

Synonyms

TNFSF9, 1B4B1, 4 1BB L, 4 1BB ligand, 4 1BBL

---

Product Information

66450-1-PBS targets 4-1BBL/TNFSF9 as part of a matched antibody pair:

MP50011-1: 66450-1-PBS capture and 66450-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12768

  Product name: Recombinant human TNFSF9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 53-254 aa of BC104805

  Sequence: WAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

• Full Name: tumor necrosis factor (ligand) superfamily, member 9
• Calculated Molecular Weight: 254 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC104805
• Gene Symbol: TNFSF9
• Gene ID (NCBI): 8744
• RRID: AB_2881819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P41273
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNFSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages.