• Featured Product
  • KD/KO Validated

4-1BBL/TNFSF9 Monoclonal antibody, PBS Only (Capture)

4-1BBL/TNFSF9 Monoclonal Antibody for WB, Sandwich ELISA, Indirect ELISA
Cat No. 66450-1-PBS
Clone No.1B4B1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Sandwich ELISA, Indirect ELISA

TNFSF9, 1B4B1, 4 1BB L, 4 1BB ligand, 4 1BBL

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66450-1-PBS targets 4-1BBL/TNFSF9 as part of a matched antibody pair:

MP50011-1: 66450-1-PBS capture and 66450-2-PBS detection (validated in Sandwich ELISA)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12768

Product name: Recombinant human TNFSF9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-254 aa of BC104805

Sequence: WAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 9
Calculated Molecular Weight 254 aa, 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC104805
Gene Symbol TNFSF9
Gene ID (NCBI) 8744
RRIDAB_2881819
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP41273
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNFSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages.

Loading...
||
New chat Able
正在加载,请稍候...