4-1BBL/TNFSF9 Monoclonal antibody

• 

  WB analysis using 66450-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66450-1-Ig (4-1BBL/TNFSF9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

4-1BBL/TNFSF9 Monoclonal Antibody for WB, ELISA

Cat No. 66450-1-Ig

Clone No.1B4B1

Publications(6)

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

TNFSF9, 1B4B1, 4 1BB L, 4 1BB ligand, 4 1BBL

---

Tested Applications

• Positive WB detected in: SKOV-3 cells, SW 1990 cells, LoVo cells, Caki-1 cells, Caki-2 cells, SCaBER cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 5 publications below
• IHC: See 2 publications below
• IF: See 1 publications below

Product Information

66450-1-Ig targets 4-1BBL/TNFSF9 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12768

  Product name: Recombinant human TNFSF9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 53-254 aa of BC104805

  Sequence: WAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

• Full Name: tumor necrosis factor (ligand) superfamily, member 9
• Calculated Molecular Weight: 254 aa, 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC104805
• Gene Symbol: TNFSF9
• Gene ID (NCBI): 8744
• RRID: AB_2881819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P41273
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNFSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Aging (Albany NY); TNFSF9 promotes metastasis of pancreatic cancer through Wnt/Snail signaling and M2 polarization of macrophages.; Authors - Jiao Wu ; KD Validated
human	WB,IF	Int Immunopharmacol; TNFSF9 promotes metastasis of pancreatic cancer by regulating M2 polarization of macrophages through Src/FAK/p-Akt/IL-1β signaling; Authors - Jiao Wu ; KD Validated
human	IHC	BMC Cancer; Clinical significance of nonerythrocytic spectrin Beta 1 (SPTBN1) in human kidney renal clear cell carcinoma and uveal melanoma: a study based on Pan-Cancer Analysis; Authors - Wenting Tang
human	WB	Hepatol Commun; HBV infection effects prognosis and activates the immune response in intrahepatic cholangiocarcinoma; Authors - Zhizhen Li
human	WB	bioRxiv; Leucine Aminopeptidase LyLAP enables lysosomal degradation of membrane proteins; Authors - Aakriti Jain
human	WB	Science; Leucine aminopeptidase LyLAP enables lysosomal degradation of membrane proteins; Authors - Aakriti Jain