• Featured Product
  • KD/KO Validated

4-1BBL/TNFSF9 Monoclonal antibody

4-1BBL/TNFSF9 Monoclonal Antibody for WB, ELISA
Cat No. 66450-1-Ig
Clone No.1B4B1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF, ELISA

TNFSF9, 1B4B1, 4 1BB L, 4 1BB ligand, 4 1BBL

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSKOV-3 cells, SW 1990 cells, LoVo cells, Caki-1 cells, Caki-2 cells, SCaBER cells, Raji cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66450-1-Ig targets 4-1BBL/TNFSF9 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag12768

Product name: Recombinant human TNFSF9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 53-254 aa of BC104805

Sequence: WAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 9
Calculated Molecular Weight 254 aa, 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC104805
Gene Symbol TNFSF9
Gene ID (NCBI) 8744
RRIDAB_2881819
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP41273
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNFSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages.

Protocols

Product Specific Protocols
WB protocol for 4-1BBL/TNFSF9 antibody 66450-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Aging (Albany NY)

TNFSF9 promotes metastasis of pancreatic cancer through Wnt/Snail signaling and M2 polarization of macrophages.

Authors - Jiao Wu
  • KD Validated
humanWB,IF

Int Immunopharmacol

TNFSF9 promotes metastasis of pancreatic cancer by regulating M2 polarization of macrophages through Src/FAK/p-Akt/IL-1β signaling

Authors - Jiao Wu
  • KD Validated
humanIHC

BMC Cancer

Clinical significance of nonerythrocytic spectrin Beta 1 (SPTBN1) in human kidney renal clear cell carcinoma and uveal melanoma: a study based on Pan-Cancer Analysis

Authors - Wenting Tang
humanWB

Hepatol Commun

HBV infection effects prognosis and activates the immune response in intrahepatic cholangiocarcinoma

Authors - Zhizhen Li
humanWB

bioRxiv

Leucine Aminopeptidase LyLAP enables lysosomal degradation of membrane proteins

Authors - Aakriti Jain
humanWB

Science

Leucine aminopeptidase LyLAP enables lysosomal degradation of membrane proteins

Authors - Aakriti Jain
Loading...
||
New chat Able
正在加载,请稍候...