4EBP1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP00559-3

  Sandwich ELISA standard curve of MP00559-3, Human 4EBP1 Recombinant Matched Antibody Pair - PBS only. 83890-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag5056. 83890-2-PBS was HRP conjugated as the detection antibody. Range: 39.06-2500 pg/mL.

• 

  Sample test of MP00559-3

  The mean 4EBP1 concentration was determined to be 375.9 ng/mL in A549 cell extract based on a 3.0 mg/mL extract load, 1,210.9 ng/mL in HepG2 cell extract based on a 8.5 mg/mL extract load, 396.7 ng/mL in K-562 cell extract based on a 5.2 mg/mL extract load and 2,456.3 ng/mL in HCT 116 cell extract based on a 6.1 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP00559-3

  Cytometric bead array standard curve of MP00559-3, 4EBP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 83890-1-PBS. Detection antibody: 83890-2-PBS. Standard: Ag5056. Range: 0.625-80 ng/mL.

4EBP1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 83890-1-PBS

Clone No.241055C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

EIF4EBP1, 4E BP1, 4E-BP1, BP 1, eIF4E binding protein 1

---

Product Information

83890-1-PBS targets 4EBP1 as part of a matched antibody pair:

MP00559-3: 83890-1-PBS capture and 83890-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5056

  Product name: Recombinant human 4EBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-118 aa of BC004459

  Sequence: MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI

• Full Name: eukaryotic translation initiation factor 4E binding protein 1
• Calculated Molecular Weight: 118 aa, 12 kDa
• GenBank Accession Number: BC004459
• Gene Symbol: EIF4EBP1
• Gene ID (NCBI): 1978
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13541
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.