Tested Applications
| Positive WB detected in | MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, LNCaP cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60188-1-Ig targets WTAP in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, drosophila |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0259 Product name: Recombinant human WTAP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-150 aa of BC000383 Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD Predict reactive species |
| Full Name | Wilms tumor 1 associated protein |
| Calculated Molecular Weight | 45 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC000383 |
| Gene Symbol | WTAP |
| Gene ID (NCBI) | 9589 |
| RRID | AB_10859484 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q15007 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
WTAP, also named as KIAA0105 and hFL(2)D, is previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 45-50 kDa due to phosphorylation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for WTAP antibody 60188-1-Ig | Download protocol |
| IHC protocol for WTAP antibody 60188-1-Ig | Download protocol |
| IP protocol for WTAP antibody 60188-1-Ig | Download protocol |
| WB protocol for WTAP antibody 60188-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-WTAP antibody (Cat# 60188-1-Ig) has accumulated 154 citations across high-impact journals including Science, Nature Communications, Nature Immunology, Nature Cell Biology, Molecular Cell, Cell Reports, and EMBO Journal. Research fields span m6A RNA methylation, oncology (breast, lung, liver, glioblastoma), neuroscience, immunology, cardiovascular disease, ferroptosis, stem cell biology, and fibrosis.
| Species | Application | Title |
|---|---|---|
Science Stem cells. m6A mRNA methylation facilitates resolution of naïve pluripotency toward differentiation. | ||
Cell Res Oncogenic AURKA-enhanced N6-methyladenosine modification increases DROSHA mRNA stability to transactivate STC1 in breast cancer stem-like cells. | ||
Cancer Commun (Lond) Targeting histone deacetylase suppresses tumor growth through eliciting METTL14-modified m6 A RNA methylation in ocular melanoma | ||
Nat Immunol The function of Wtap in N6-adenosine methylation of mRNAs controls T cell receptor signaling and survival of T cells. | ||
Bioact Mater Dual-modal antioxidant and epigenetic synergy attenuates the self-perpetuating senescence cycle in osteoarthritis. | ||
Nat Cell Biol Redox regulation of m6A methyltransferase METTL3 in β-cells controls the innate immune response in type 1 diabetes |
Reviews
What customers say
Both reviewers used this antibody for Western Blot with positive results. One user (5/5) reported clean WTAP detection with no undesired bands at a 1:1000 dilution in human lung cancer cell lines (Ludlu-1, H1299, A549), incubating overnight at 4°C. Another user (4/5) successfully detected WTAP in RCC4 human cells at a 1:2000 dilution, comparing normoxic versus hypoxic conditions. Overall, the antibody is well-received for its specificity and reliable performance in Western Blot applications across different human cell lines.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nikolett (Verified Customer) (09-05-2025) | This is antibody is working well do detect WTAP without any undesired band. I used it as 1:1000 dilution, incubated overnight at 4°C.
|
Daniel (Verified Customer) (06-25-2019) | RCC4 grown in normoxic (left lane) and hypoxic (right lane) conditions.
 |
