WTAP Monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WTAP Monoclonal antibody, PBS Only (60188-1-PBS)

• Featured Product
• KD/KO Validated

WTAP Monoclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 60188-1-PBS Copied!

Clone No. 4A10G9

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

4A10G9, Female-lethal(2)D homolog (hFL(2)D ), FL2D, KIAA0105, Mum2

• 

  WB analysis using 60188-1-Ig (same clone as 60188-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60188-1-Ig (WTAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60188-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 60188-1-Ig (same clone as 60188-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60188-1-Ig (WTAP antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 60188-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 60188-1-Ig (same clone as 60188-1-PBS)

  IP result of anti-WTAP (IP:60188-1-Ig, 4ug; Detection:10200-1-AP 1:8000) with HeLa cells lysate 2000 ug. This data was developed using the same antibody clone with 60188-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 60188-1-Ig (same clone as 60188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60188-1-Ig (WTAP antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60188-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 60188-1-Ig (same clone as 60188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 60188-1-Ig (WTAP antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60188-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 60188-1-Ig (same clone as 60188-1-PBS)

  Immunofluorescent analysis of (4% PFA ) fixed HeLa cells using 60188-1-Ig(WTAP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60188-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WTAP in ?

Chat with Able

---

Product Information

60188-1-PBS targets WTAP in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0259

  Product name: Recombinant human WTAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-150 aa of BC000383

  Sequence: TNEEPLPKKVRLSETDFKVMARDELILRWKQYEAYVQALEGKYTDLNSNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECTTQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQTKDKLEQAQNELSAWKFTPD

• Full Name: Wilms tumor 1 associated protein
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC000383
• Gene Symbol: WTAP
• Gene ID (NCBI): 9589
• RRID: AB_10859484
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q15007
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WTAP, also named as KIAA0105 and hFL(2)D, is previously identified as a protein associated with Wilms' tumor-1 (WT-1) protein that is essential for the development of the genitourinary system. It is a Pre-mRNA-splicing regulator protein. It is a regulatory subunit of the WMM N6-methyltransferase complex which plays a role in the efficiency of mRNA splicing and processing and mRNA stability. It is required for accumulation of METTL3 and METTL14 to nuclear speckle. MW of WTAP is 45-50 kDa due to phosphorylation.

Publications

What published studies show

The WTAP Monoclonal antibody (4A10G9), catalog number 60188-1-PBS, has 1 citation. It appears in NPJ Precision Oncology (2025), a study on m6A reader IGF2BP2-stabilized lncRNA LHX1-DT inhibiting renal cell carcinoma cell proliferation and invasion by sponging miR-590-5p. The associated research fields include m6A RNA modification, lncRNA biology, and renal cell carcinoma. The antibody was used in Western blot (WB) on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	NPJ Precis Oncol; m6A reader IGF2BP2-stabilized lncRNA LHX1-DT inhibits renal cell carcinoma (RCC) cell proliferation and invasion by sponging miR-590-5p; Authors - Chunming Zhu