Tested Applications
| Positive WB detected in | HEK-293 cells, SH-SY5Y cells, U-251 cells, mouse brain tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | RAW 264.7 cells, SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:8000 |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66674-1-Ig targets PARK2/Parkin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, sheep |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5179 Product name: Recombinant human Parkin protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 81-387 aa of BC022014 Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK Predict reactive species |
| Full Name | Parkinson disease (autosomal recessive, juvenile) 2, parkin |
| Calculated Molecular Weight | 52 kDa |
| Observed Molecular Weight | 42-52 kDa |
| GenBank Accession Number | BC022014 |
| Gene Symbol | Parkin |
| Gene ID (NCBI) | 5071 |
| RRID | AB_2882028 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O60260 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a viariety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PARK2/Parkin antibody 66674-1-Ig | Download protocol |
| IHC protocol for PARK2/Parkin antibody 66674-1-Ig | Download protocol |
| WB protocol for PARK2/Parkin antibody 66674-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PARK2/Parkin Monoclonal antibody (2H5A7), catalog number 66674-1-Ig, has accumulated 99 citations. Citations appear in high-impact journals including Nature, Nature Communications, Autophagy, Cell Death & Differentiation, Journal of Clinical Investigation, Redox Biology, Free Radical Biology and Medicine, Oncogene, and FASEB Journal, among many others. Research fields covered include mitophagy, Parkinson's disease, neurodegeneration, cancer, diabetes, cardiovascular disease, oxidative stress, ferroptosis, bone metabolism, and inflammation.
| Species | Application | Title |
|---|---|---|
Bone Res Enhanced SIRT3 expression restores mitochondrial quality control mechanism to reverse osteogenic impairment in type 2 diabetes mellitus | ||
Autophagy CircEPS15, as a sponge of MIR24-3p ameliorates neuronal damage in Parkinson disease through boosting PINK1-PRKN-mediated mitophagy | ||
Autophagy KDM4A-induced tumor senescence enhances the efficacy of immunotherapy by inhibiting AGT-PHB1 axis-mediated mitophagy in colorectal cancer | ||
Nat Commun Remodeling adipocytes' lipid metabolism with a polycation loaded enzyme-active framework reverses osteoporotic bone marrow | ||
Nat Commun An AI-assisted fluorescence microscopic system for screening mitophagy inducers by simultaneous analysis of mitophagic intermediates |
Reviews
What customers say
Users report mixed results for this Parkin antibody in Western Blot. One reviewer found no bands with the recommended PBS-T + 5% milk buffer, though TBS-T + 5% milk produced bands, albeit with unclear specificity. Another noted it worked well when freshly prepared but lost activity after freezing in 3% BSA. A third reviewer confirmed good performance in mouse brain tissue at 1:500 dilution. Overall, the antibody shows potential for WB but may require buffer optimization and should be used fresh rather than frozen.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rhiannon (Verified Customer) (09-16-2026) | No bands with PBS-T + 5% milk as advised on data sheet. Antibody trialled in TBS-T + 5% milk with bands throughout the gel. Unclear which band is specific to Parkin which could lead to false interpretation.
 |
Paula (Verified Customer) (07-26-2024) | Worked well for Western Blotting when made fresh. However, after freezing antibody stock (in 3% BSA) did not work.
 |
Tanusree (Verified Customer) (12-03-2019) | This antibody works good in western blotting analysis using mouse tissues.
|
