Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, rat brain tissue, mouse brain tissue, pig brain tissue |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | rat colon tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells, MDCK cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:950-1:3800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
81115-1-RR targets Beta Actin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, canine, monkey, chicken, zebrafish, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag14521 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-50 aa of BC002409 Sequence: MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK Predict reactive species |
| Full Name | actin, beta |
| Calculated Molecular Weight | 375 aa, 42 kDa |
| Observed Molecular Weight | 42 kDa |
| GenBank Accession Number | BC002409 |
| Gene Symbol | Beta Actin |
| Gene ID (NCBI) | 60 |
| RRID | AB_2923704 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P60709 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40, 31, 15 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody was generated against N-terminal region of human beta actin protein and can cross-react with other actins. (9173887, 11217076, 10229193 )
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| IHC protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| IP protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| WB protocol for Beta Actin antibody 81115-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Beta Actin Recombinant monoclonal antibody (4H1), catalog number 81115-1-RR, has 1,397 citations. Publications appear in journals including Cell, Nature Communications, Nature Cell Biology, Cancer Cell, Immunity, Nature Metabolism, Nature Immunology, Nature Genetics, Nature Microbiology, Cell Metabolism, Cell Research, Molecular Cancer, Advanced Science, Advanced Materials, Redox Biology, Cell Death & Differentiation, and others. Research fields encompass oncology, ferroptosis, metabolism, immunology, neuroscience, cardiology, liver disease, wound healing, nanomedicine, and bone biology, with Western blotting as the predominant application.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther The noncanonical function of liver-type phosphofructokinase potentiates the efficacy of HDAC inhibitors in cancer. | ||
Signal Transduct Target Ther Targeting N(1)-methyladenosine modification in osteoblasts through tRNA methyltransferase 10C reverses mitochondrial dysfunction and ameliorates osteoporosis. | ||
Cancer Cell Cancer cell-derived arginine fuels polyamine biosynthesis in tumor-associated macrophages to promote immune evasion | ||
Cell EBV infection and HLA-DR15 jointly drive multiple sclerosis by myelin peptide presentation. | ||
Mol Cancer tRNA m(2)G methyltransferase complex THUMPD3-TRMT112 promotes pancreatic cancer progression and autophagy via modulating TFEB translation. | ||
Mol Cancer A novel polypeptide CAPG-171aa encoded by circCAPG plays a critical role in triple-negative breast cancer |
Reviews
What customers say
Customer reviews for this antibody are mixed. Two users gave 5-star ratings for Western blotting, praising a single sharp band at the expected molecular weight with no off-target signals and calling it "top for WB." However, one user rated it 2 stars for immunofluorescence on rat neurons, reporting the antibody did not appear specific for actin and mainly produced punctate signal. Overall, the antibody performs well for WB but may have specificity concerns in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
YINGJIAN (Verified Customer) (07-24-2025) | In Western blotting, the antibody produced a single, sharp band corresponding to the theoretical size of the target protein, without detectable off-target bands
 |
Mai Dan (Verified Customer) (02-05-2025) | The antibody doesn't look specific for actin. I observed mainly puncta signal.
|
Y (Verified Customer) (01-31-2025) | TOP for WB
|
