A1CF Recombinant monoclonal antibody

• 

  WB analysis using 84322-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84322-4-RR (A1CF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse colon using 84322-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84322-4-RR (A1CF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse colon using 84322-4-RR

  Immunohistochemical analysis of paraffin-embedded mouse colon tissue slide using 84322-4-RR (A1CF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84322-4-RR

  Biolayer interferometry (BLl) kinetic assays of 84322-4-RR against Human A1CF were performed. The affinity constant is 0.191 nM.

A1CF Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84322-4-RR

Clone No.241644F10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

APOBEC1CF, APOBEC1 complementation factor, ACF65, ACF64, ACF

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IHC detected in: mouse colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84322-4-RR targets A1CF in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag22929

  Product name: Recombinant human A1CF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-122 aa of BC054873

  Sequence: MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIR

• Full Name: APOBEC1 complementation factor
• Calculated Molecular Weight: 594 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC054873
• Gene Symbol: A1CF
• Gene ID (NCBI): 29974
• RRID: AB_3671864
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NQ94
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.